KEGG   Cupriavidus taiwanensis: RALTA_A2626Help
Entry
RALTA_A2626       CDS       T00702                                 

Definition
guanyl-specific ribonuclease (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
cti  Cupriavidus taiwanensis
Brite
Enzymes [BR:cti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     RALTA_A2626
Transfer RNA biogenesis [BR:cti03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    RALTA_A2626
 Prokaryotic Type
    RALTA_A2626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2781351..2781722)
Genome map
AA seq 123 aa AA seqDB search
MLARSLTGAALVLALAQPTLARQAQTEGLGTIAVQQLPNEARQTLERIEAGGPFPYDKDG
SRFGNYERILPQRERGYYREYTVKSARSRNRGAKRIVCGGEQRAANDCYYTEDHYNSFKR
ILK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgctggcccggtccctgaccggcgcggcgctggtgctggccctggcgcagccgacgctg
gcacgccaggcgcagaccgaagggctgggaaccattgcagtgcagcagttgcccaatgaa
gcacggcagaccctggagcgcatcgaagccggcggcccgttcccgtatgacaaggacggt
tcccgattcggcaattacgaacgcatcctgccgcaaagagaacgcggctattaccgcgaa
tacacggtcaagagcgccaggagccggaaccggggagccaagcggatcgtctgcggcggg
gaacagcgcgccgccaacgattgttactacacggaagaccactacaacagcttcaaacgg
atactcaaatga

DBGET integrated database retrieval system