KEGG   Cupriavidus taiwanensis: RALTA_A2702Help
Entry
RALTA_A2702       CDS       T00702                                 

Gene name
proB
Definition
(GenBank) gamma-glutamate kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00330  Arginine and proline metabolism
cti00332  Carbapenem biosynthesis
cti01100  Metabolic pathways
cti01130  Biosynthesis of antibiotics
cti01230  Biosynthesis of amino acids
Module
cti_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RALTA_A2702 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    RALTA_A2702 (proB)
Enzymes [BR:cti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     RALTA_A2702 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CAQ70633
UniProt: B3R897
Position
1:complement(2859808..2860926)
Genome map
AA seq 372 aa AA seqDB search
MQSVIAQAKRIVVKVGSSLVTNDGKGLDHDAIARWAAQIARLRVAGKEVVLVSSGAIAEG
MQRLGWARRPKEIHELQAAAAVGQMGLAQVYESQFTRYGIRTAQVLLTHADLADRERYLN
ARSTLLTLLSLGVVPIINENDTVVTDEIKFGDNDTLGALVTNLIEGDALVILTDQRGLYT
ADPRKDPAAQFVDEALAGTPELEAMAGGAGTSIGRGGMLTKILAAKRAAKSGAHTTIASG
REANVLERLAAGEAIGTQLLAPTGRLTARKQWMADHLQLRGRVVIDGGAVEKLTSGGKSL
LPIGVVEVQGEFARGEVIACVDAQGKEVARGITNYSSAESRLIARKPSSEIESVLGHLNE
PELIHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcggtcatcgcgcaggcaaagcgcatcgtcgtcaaagtgggctccagcctggtc
accaacgacggcaaggggctggaccacgacgccatcgcccgctgggccgcccagatcgca
agactgcgcgtggccggcaaggaagtggtgctggtcagttccggcgccattgccgaaggc
atgcagcggcttggctgggcgcgccgcccgaaggaaatccatgagctgcaggccgccgcg
gcggtgggccagatggggctggcgcaggtctatgaaagccagttcacccgctacggcatc
cgcaccgcgcaggtgctgctgacccacgccgacctggccgaccgcgagcgctacctgaac
gcccgctccacactgctgacgctgctgtcgctgggcgtggtgccgatcatcaacgagaac
gacaccgtggtcaccgacgaaatcaagttcggcgacaacgacacgctgggcgcgctggtc
accaacctgatcgaaggcgacgcgctggtgatcctgaccgaccagcgcggcctgtacacc
gccgatccgcgcaaggacccggccgcgcagttcgtcgacgaggccctggccggcacgccc
gagctggaagccatggccggcggcgccggcacgtcgatcggccgcggcggcatgctgacc
aagatcctggcggccaagcgcgcggccaagtccggcgcgcataccaccatcgcctcgggc
cgcgaggccaacgtgctggagcgcctggccgccggcgaggcgatcggcacccagctgctg
gcgccgaccggccggctgaccgcgcgcaagcagtggatggccgaccacctgcagctgcgc
ggccgcgtcgtgatcgacggcggcgcggtcgagaagctgaccagcggcggcaagtcgctg
ctgccgatcggcgtggtcgaagtgcagggcgaattcgcccgcggcgaagtgatcgcctgt
gtcgatgcgcaaggcaaggaggtggcgcgcggcatcaccaactattccagcgccgagtcg
cggctgatcgcgcgcaagccgtcgtccgagatcgaatcggtgctcgggcacctgaacgag
cccgaactgatccatcgcgacaacctggtgctggtctga

DBGET integrated database retrieval system