KEGG   Cupriavidus taiwanensis: RALTA_A2759Help
Entry
RALTA_A2759       CDS       T00702                                 

Gene name
badK
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cti  Cupriavidus taiwanensis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RALTA_A2759 (badK)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RALTA_A2759 (badK)
   00650 Butanoate metabolism
    RALTA_A2759 (badK)
  Lipid metabolism
   00071 Fatty acid degradation
    RALTA_A2759 (badK)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RALTA_A2759 (badK)
   00310 Lysine degradation
    RALTA_A2759 (badK)
   00360 Phenylalanine metabolism
    RALTA_A2759 (badK)
   00380 Tryptophan metabolism
    RALTA_A2759 (badK)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RALTA_A2759 (badK)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RALTA_A2759 (badK)
   00281 Geraniol degradation
    RALTA_A2759 (badK)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RALTA_A2759 (badK)
   00627 Aminobenzoate degradation
    RALTA_A2759 (badK)
   00930 Caprolactam degradation
    RALTA_A2759 (badK)
Enzymes [BR:cti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RALTA_A2759 (badK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2927129..2927905)
Genome map
AA seq 258 aa AA seqDB search
MPYENILVETRGRVGLVTLNRPKALNALNDALMDELGAALTAFDQDEGIGAIVITGSERA
FAAGADIGMMAKYSFMDVYKGDYITRNWETIRKIRKPVIAGVAGYALGGGCELAMMCDII
IAADSAKFGQPEVKLGTMPGAGGTQRLPRAVSKAKAMDLCLTARMMDAAEAERAGLVSRV
VPADKLLDEVLAAAETVAGFSLPVVMMIKESVNAAYETTLAEGVHFERRLFHATFATEDQ
KEGMAAFVEKRSPNFQHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacgagaacatcctggtcgagacccgcggccgcgttggcctggtcacgctgaac
cgcccgaaggccctgaatgcgctcaatgacgcgttgatggatgaactgggcgccgcgctg
accgcgttcgaccaggatgaagggatcggcgccatcgtcatcaccggcagcgagcgcgcc
tttgccgccggcgccgacatcggcatgatggccaagtactccttcatggatgtctacaag
ggcgactacatcacccgcaactgggaaaccatccgcaagatccgcaagccagtcatcgcg
ggcgtagccggttatgcgctgggcggcggctgcgaactggcgatgatgtgcgacatcatc
atcgcggcggattcggcgaagttcgggcagcccgaggtcaagctcggcaccatgcccggc
gcgggcggcacgcagcgcctgccgcgcgcggtgtccaaggccaaggcgatggacctgtgc
ctgaccgcgcgcatgatggacgccgctgaagccgagcgcgcgggcctggtgtcgcgcgtg
gtgccggccgacaagctgctggacgaagtgctggcggcggccgagaccgtcgccgggttc
tcgctccccgtcgtcatgatgatcaaggaatcggtcaacgccgcctacgagaccacgctg
gccgagggcgttcacttcgagcgtcggcttttccacgccaccttcgccacggaagaccag
aaagagggcatggccgccttcgtcgagaagcgcagcccgaatttccagcaccgttaa

DBGET integrated database retrieval system