KEGG   Cupriavidus taiwanensis: RALTA_A2784Help
Entry
RALTA_A2784       CDS       T00702                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cti  Cupriavidus taiwanensis
Brite
Enzymes [BR:cti01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     RALTA_A2784
Secretion system [BR:cti02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   RALTA_A2784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2952079..2952837)
Genome map
AA seq 252 aa AA seqDB search
MFPSLRRRPAVYATITAIAGGLAAAGFALHAMAAGEPGTDRIKESLQKMLGGRAEVKSVG
KTPVPGLFEANIGGQVVYTDATGRYILNGEMIDTRTGTNLTEERLAEINRIKWSDLPLAR
AIKWSKGDGSRQIAVFSDPNCGYCKRIEQTFQQMDNITVYTFLYPVLSPDSETKSKQVWC
AADRTKAWRDWMLKQVALTGNGSCKTPLEENLALGHSMNVTGTPAVFFTDGTRIPGAADV
ATLERKLASIKK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgttcccatccctgcgccgccgtcccgccgtctacgccaccatcaccgccatcgccggc
ggactggccgcggccggcttcgcgctgcacgccatggcggcgggcgagcccggcaccgac
cgcatcaaggaatccctgcagaagatgctgggcggccgcgccgaagtgaagagcgtcggc
aagactccggtgccgggcctgttcgaagccaatatcggcggccaggtggtgtacaccgat
gccaccgggcgctacatcctgaacggcgagatgatcgatacccgcaccggcaccaacctg
accgaggagcggctggccgagatcaaccgcatcaagtggtcggacctgccgctggcgcgc
gcgatcaagtggagcaagggcgatggcagccgccagatcgcggtgttctccgaccccaac
tgcggctactgtaagcgcatcgaacaaaccttccagcagatggacaacatcacggtgtac
accttcctgtacccggtgctgtcgccggattcggagaccaagtcgaaacaggtctggtgc
gcggccgaccgcaccaaggcctggcgcgactggatgctcaagcaggtggcgctgaccggc
aacggcagctgcaagacgccgctggaagagaacctggcgctgggccacagcatgaacgtg
accggcacccccgcggtgttcttcaccgacggcacccgcatccccggcgcggcggacgtc
gccacgctggaacgcaagctcgccagcatcaagaaataa

DBGET integrated database retrieval system