KEGG   Cupriavidus taiwanensis: RALTA_B0267Help
Entry
RALTA_B0267       CDS       T00702                                 

Gene name
aceA2
Definition
(GenBank) Isocitrate lyase; Isocitrase; Isocitratase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00630  Glyoxylate and dicarboxylate metabolism
cti01100  Metabolic pathways
cti01110  Biosynthesis of secondary metabolites
cti01120  Microbial metabolism in diverse environments
cti01200  Carbon metabolism
Module
cti_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RALTA_B0267 (aceA2)
Enzymes [BR:cti01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RALTA_B0267 (aceA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CAP63465
UniProt: B2AI66
Position
2:complement(287796..289376)
Genome map
AA seq 526 aa AA seqDB search
MAQYQDDIKAVAALKETQGSAWNAINPEYAARMRAQNKFKTGLDIAKYTAKIMRADMAAY
DADPSKYTQSLGCWHGFIAQQKMISIKKHFNSTERRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIRELYTFLRQADARELGGLFRQLDAATGAEKAAIQQKIDNHVTHVVPIIAD
IDAGFGNAEATYLLAKQFIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKIRAIR
YAFLELGVDDGIIVARTDSLGAGLTKQIAVTAKPGDLGDQYNSFLDCEELSADQLGNGDV
IIKRDGKLLRPKRLPSNLFQFRAGTGEARCVLDCVTALQNGADLLWIETEKPHIAQIAGM
VNEIRKVIPNAKLVYNNSPSFNWTLNFRQQAYDAMKEAGKDVSAYDRAQLMSVEYDDSEL
AKLADEKIRTFQADASREAGIFHHLITLPTYHTAALSTDNLAKEYFGDQGMLGYVAGVQR
KEIRQGIACVKHQNMSGSDIGDDHKEYFSGEAALKAAGKDNTMNQF
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtatcaagacgacatcaaggcagtggctgctttgaaagaaacccagggcagc
gcctggaatgccatcaaccccgagtacgctgcccgcatgcgcgcgcagaacaagttcaag
acgggcctggacatcgccaagtacaccgccaagatcatgcgcgccgacatggcggcctat
gacgcggacccgtccaagtacacccagtcgctgggctgctggcatggctttatcgcccag
cagaagatgatttccatcaagaagcacttcaacagcaccgaacgccgctacctgtacctg
tccggctggatggtcgccgcgctgcgctccgagttcggcccgctgcccgaccagtcgatg
cacgagaagacctcggtcagcgcgctgatccgcgagctgtacaccttcctgcgccaggcc
gacgcccgtgaactgggcggcctgttccgccagctcgacgccgccaccggcgccgaaaag
gctgcgatccagcagaagatcgacaaccacgtcacccacgtggtgcccatcatcgccgac
atcgacgccggtttcggcaacgccgaagcgacctacctgctggccaagcaattcatcgaa
gccggcgcctgctgcatccagatcgaaaaccaggtctccgacgagaagcaatgcggccac
caggacggcaaggtcaccgtgccgcacgaagacttcctggccaagatccgcgccatccgc
tacgccttcctggaactgggcgtggacgacggcatcatcgtcgcccgcaccgactcgctg
ggcgccggcctgaccaagcagatcgccgtgaccgccaagccgggcgacctgggcgaccag
tacaactcgttcttggattgcgaagaactgtcggccgaccagctgggcaatggcgacgtc
atcatcaagcgcgacggcaagctgctgcgcccgaagcgcctgcccagcaacctgttccag
ttccgcgccggcacgggcgaagcacgctgcgtgctggactgcgtgaccgcgctgcagaac
ggcgccgacctgctgtggatcgaaaccgaaaagccgcacatcgcccagatcgccggcatg
gtcaacgaaatccgcaaggtcatcccgaacgccaagctggtgtacaacaacagcccgtcg
ttcaactggacgctgaatttccgccagcaggcgtatgacgcgatgaaggaagcgggcaag
gacgtgtcggcatatgaccgcgcccagctgatgagcgtggaatatgatgacagtgagctg
gcgaagctggcggacgagaagatccggacgttccaggctgatgcgtcgcgggaggcgggg
atcttccatcatctgattacgctgccgacgtatcacactgctgcgctgtcgacggacaat
ctggctaaggaatacttcggcgatcaaggcatgctgggctacgtcgctggcgtgcagcgg
aaggaaattcggcagggcatcgcctgcgtcaagcaccagaacatgtcgggctcggatatc
ggtgatgaccacaaggagtatttcagcggcgaagcggcgctgaaggcggcggggaaggac
aatactatgaatcagttttga

DBGET integrated database retrieval system