KEGG   Cupriavidus taiwanensis: RALTA_B0267Help
Entry
RALTA_B0267       CDS       T00702                                 

Gene name
aceA2
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cti  Cupriavidus taiwanensis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:cti01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cti00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(287796..289376)
Genome map
AA seq 526 aa AA seqDB search
MAQYQDDIKAVAALKETQGSAWNAINPEYAARMRAQNKFKTGLDIAKYTAKIMRADMAAY
DADPSKYTQSLGCWHGFIAQQKMISIKKHFNSTERRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIRELYTFLRQADARELGGLFRQLDAATGAEKAAIQQKIDNHVTHVVPIIAD
IDAGFGNAEATYLLAKQFIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKIRAIR
YAFLELGVDDGIIVARTDSLGAGLTKQIAVTAKPGDLGDQYNSFLDCEELSADQLGNGDV
IIKRDGKLLRPKRLPSNLFQFRAGTGEARCVLDCVTALQNGADLLWIETEKPHIAQIAGM
VNEIRKVIPNAKLVYNNSPSFNWTLNFRQQAYDAMKEAGKDVSAYDRAQLMSVEYDDSEL
AKLADEKIRTFQADASREAGIFHHLITLPTYHTAALSTDNLAKEYFGDQGMLGYVAGVQR
KEIRQGIACVKHQNMSGSDIGDDHKEYFSGEAALKAAGKDNTMNQF
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtatcaagacgacatcaaggcagtggctgctttgaaagaaacccagggcagc
gcctggaatgccatcaaccccgagtacgctgcccgcatgcgcgcgcagaacaagttcaag
acgggcctggacatcgccaagtacaccgccaagatcatgcgcgccgacatggcggcctat
gacgcggacccgtccaagtacacccagtcgctgggctgctggcatggctttatcgcccag
cagaagatgatttccatcaagaagcacttcaacagcaccgaacgccgctacctgtacctg
tccggctggatggtcgccgcgctgcgctccgagttcggcccgctgcccgaccagtcgatg
cacgagaagacctcggtcagcgcgctgatccgcgagctgtacaccttcctgcgccaggcc
gacgcccgtgaactgggcggcctgttccgccagctcgacgccgccaccggcgccgaaaag
gctgcgatccagcagaagatcgacaaccacgtcacccacgtggtgcccatcatcgccgac
atcgacgccggtttcggcaacgccgaagcgacctacctgctggccaagcaattcatcgaa
gccggcgcctgctgcatccagatcgaaaaccaggtctccgacgagaagcaatgcggccac
caggacggcaaggtcaccgtgccgcacgaagacttcctggccaagatccgcgccatccgc
tacgccttcctggaactgggcgtggacgacggcatcatcgtcgcccgcaccgactcgctg
ggcgccggcctgaccaagcagatcgccgtgaccgccaagccgggcgacctgggcgaccag
tacaactcgttcttggattgcgaagaactgtcggccgaccagctgggcaatggcgacgtc
atcatcaagcgcgacggcaagctgctgcgcccgaagcgcctgcccagcaacctgttccag
ttccgcgccggcacgggcgaagcacgctgcgtgctggactgcgtgaccgcgctgcagaac
ggcgccgacctgctgtggatcgaaaccgaaaagccgcacatcgcccagatcgccggcatg
gtcaacgaaatccgcaaggtcatcccgaacgccaagctggtgtacaacaacagcccgtcg
ttcaactggacgctgaatttccgccagcaggcgtatgacgcgatgaaggaagcgggcaag
gacgtgtcggcatatgaccgcgcccagctgatgagcgtggaatatgatgacagtgagctg
gcgaagctggcggacgagaagatccggacgttccaggctgatgcgtcgcgggaggcgggg
atcttccatcatctgattacgctgccgacgtatcacactgctgcgctgtcgacggacaat
ctggctaaggaatacttcggcgatcaaggcatgctgggctacgtcgctggcgtgcagcgg
aaggaaattcggcagggcatcgcctgcgtcaagcaccagaacatgtcgggctcggatatc
ggtgatgaccacaaggagtatttcagcggcgaagcggcgctgaaggcggcggggaaggac
aatactatgaatcagttttga

DBGET integrated database retrieval system