KEGG   Cupriavidus taiwanensis: RALTA_B0291Help
Entry
RALTA_B0291       CDS       T00702                                 

Gene name
bcsZ
Definition
(GenBank) endo-1,4-D-glucanase; glycosyl hydrolase 8 (cellulase D) family; signal peptide (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
cti  Cupriavidus taiwanensis
Brite
Enzymes [BR:cti01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     RALTA_B0291 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(315159..316340)
Genome map
AA seq 393 aa AA seqDB search
MTDQTRRRYVTYACALGASALTAAWPTETRAHAPPATRRASRWPLYRQFLERFVQADGRV
IDYSTPTLQSTSEGQSYGMVFALVADDRDAFDRLWRWSVAHLGNGRLDDKLPAWQWGRRA
DGTWGVLDRNPAADADLWFAFALAEAARLWQAPSYADAARALLRRVAAQEVVTLPGFGPM
LLPGPQGFIDDGPDGSRRWRLNASYLPVPLLRRLAAFDPSGPWDKLAAQVARLIGAVSHA
GIVPDWSAYRVGGRRQGFVRDPVKGDVSSYDAVRVYLWAGMTPDQDSTWGAIMQALLPNA
ARLAGRAAPPEKMYAESGKVEGIGPPAFSAALLPFLQAAGSPALATQMARAQKIVGAPPG
PGGPTYYDTVLGLFGLGFMEGRYRFSASGQLDR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccaaacccgccgccgttacgtgacttatgcctgcgcgctcggcgccagcgcg
ctgaccgccgcatggcccaccgagacgcgcgcccacgcgccgcctgccacgcggcgcgca
tcccgctggccgctctaccggcagtttctggaacgcttcgtgcaggcggatgggcgcgtc
atcgactactccacgcccacgttgcaaagcacctccgagggccagtcctacggcatggtg
ttcgcgctggtcgccgatgaccgcgatgcgttcgaccgtctgtggcgctggagcgtcgcc
caccttggcaatggtcgcctggacgacaagctgccggcatggcagtggggccggcgcgcc
gacggcacgtggggcgtgctggaccgcaatccggctgccgatgccgacctgtggttcgcg
ttcgcgctggcggaggcggcgcgcctgtggcaagccccttcctacgctgacgcggcacgt
gccttgctgcggcgggtggcagcgcaggaggtggtgacattgcccggcttcggcccgatg
ctgctgcccggtccgcaagggtttatcgacgatggccccgacggctcgcgccgctggcgt
ctcaatgccagctatctgccggtaccgctgctgcgccggctcgccgccttcgacccgtcc
ggcccgtgggacaagctggccgcacaggtggccaggctgatcggcgcggtgtcccatgcc
ggcatcgtgccggactggtcggcctaccgcgtcggggggcgccggcagggattcgtgcgc
gatccggtcaagggagacgtcagcagctatgacgccgtgcgggtctacctgtgggctggc
atgacgcctgatcaagacagtacgtggggcgcgatcatgcaggcgctgctgcccaatgcg
gcgcgcctggcagggcgtgcggcaccgccggagaagatgtacgccgaaagcggcaaggtc
gaaggcatcggaccgcccgctttctccgccgcgctgctgccgttcctgcaggccgctggc
tcgcccgctctggccacccagatggcacgtgcgcagaagattgtgggcgcaccgccgggg
ccaggcggcccgacctactatgacacggtgctgggcctgttcgggcttgggtttatggaa
gggcgctaccggttctccgcgtcgggccagctcgacaggtga

DBGET integrated database retrieval system