KEGG   Cupriavidus taiwanensis: RALTA_B0356Help
Entry
RALTA_B0356       CDS       T00702                                 

Definition
thymidine phosphorylase (EC:2.4.2.2 2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cti  Cupriavidus taiwanensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RALTA_B0356
Enzymes [BR:cti01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RALTA_B0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(396012..397817)
Genome map
AA seq 601 aa AA seqDB search
MNASGTFFFVVGPSGAGKDALMDGARAALDDNYVFARRVITRPEGAVGEAHEAVSEAEFA
RRQRSGEFLVTWDAHDLRYGLPCSLMSELERGRHVVANGSRAVIAELAQRLPRFVVVLVT
APQDVLARRIAARGRESGEQIARRVARTGAALPPEVRCLTVLNDSTLEVGRARFVEALRH
GTRVASDGAPASRTNLMAKLRGEPLDQAAYVAVLQDAMAGRYTEAELTEFLVAATRSLDD
QEVVALARARTVFTPRIKWDEPIVVDKHSIGGVPGSRITLIVVPIVAAYGLAMPKTSSRA
ITSAAGTADAMETVARVDLAHDDVRRCVAQARACIAWNGRLNHSVVDDVMNAITRPLRLD
SRRWAVASILSKKYTAGATHVIVDLPYGPQTKLATRADAEALGAMFEHVGKGLGLHVRAL
VTDGSRPIGRGIGPALEVRDVRQVLANDPCAPADLREKALRFAGEIIAFDARVGSPAEGL
RIATALLSEGKAKAAFDRIAATQGARPEPVAPGAHTCVVSATMQGRVAAIDGLRISGVAR
AAGAPRELGAGVDLLCTIGAKVESGQPLYRIHAGSDAALAAAAALARAGGECSEAVRIDP
D
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgagcggcacgttcttctttgtggtgggccccagcggcgcgggcaaggatgcg
ctgatggacggggcgcgggcggcgctcgatgacaactatgtattcgcccggcgcgtcatc
acgcggcccgagggtgcggtcggagaggcgcatgaagccgtgtcggaagccgagttcgca
cggcgccagcgcagcggcgaatttctggtgacctgggatgcgcacgacctgcgctatggc
ttgccctgctcgctgatgtcggagctcgagcgcgggcgccacgtcgtcgccaacggctcg
cgtgccgtcatcgcggaactagcgcaacgcctgccgcgcttcgtggtggtgttggtgacg
gcgccgcaggacgtgctagcccgccgcattgccgcgcgcgggcgcgaatctggcgagcag
attgcccgccgcgtggcgcggaccggcgcggcgctgcctccggaagtccggtgcctgacg
gtgttgaacgacagcacgctggaggtaggcagggcccgcttcgtcgaggcgctgcggcac
ggcacgcgcgtagccagtgacggagcgccggccagccgcaccaacctgatggccaagctg
cgcggcgagccgctcgaccaagccgcctacgtcgcggtgctgcaggacgccatggcaggc
cgctacaccgaggccgagctgaccgaattcctggtcgccgcaacccgctcgctggacgac
caggaggtggtggcactggcacgtgcacgtacggtgttcacgccccgcatcaaatgggac
gagccgatcgtggtcgacaagcactccatcggcggcgtgcccggcagccgcatcacgctg
atcgtggtgccgatcgtcgcggcgtatggcctggccatgcccaagacttcatcgcgcgcg
attacttccgctgccggcacggccgacgccatggaaaccgtcgcgcgcgtcgacctggcg
cacgacgacgtgcgccgctgcgtggcccaggcgcgcgcatgcatcgcatggaacggccgc
ctcaaccattccgtggtcgacgacgtgatgaacgccatcacgcgtccgctgcggctggat
tcgcggcgctgggccgtggcgtcgatcctttccaagaaatacaccgccggggctacccac
gtcatcgtcgaccttccctatgggccgcagaccaagctggccacgcgcgccgacgccgag
gcgctgggcgcgatgttcgagcacgtcggcaagggactcggcctgcatgtacgtgcgctg
gtgaccgacggcagccggccaatcggccgcggcatcgggcccgccctggaagtgcgcgat
gtccgccaggtcctcgccaacgatccctgtgcccccgcggacctgcgagagaaggccttg
cgcttcgccggcgaaatcatcgccttcgatgcgcgcgtgggctcgcctgctgagggcctg
cgcattgccaccgctctgctcagcgaaggcaaggccaaggccgcattcgaccgtattgcc
gccacgcaaggcgcgcgacccgagcccgtggcgcccggtgcgcatacctgcgtggtgagc
gcgaccatgcaaggccgcgtggccgccatcgatggactgcgcatctccggggtcgcgcgc
gccgccggggcgccgcgcgagctcggtgcgggcgtcgatctgctgtgcacgatcggggca
aaggtggagtcagggcaacccctctaccgaatccatgctgggagcgatgcggcacttgcc
gcggccgcggcactggcacgcgcgggcggcgagtgcagcgaggcggtgcgtatagacccc
gattga

DBGET integrated database retrieval system