KEGG   Cupriavidus taiwanensis: RALTA_B0400Help
Entry
RALTA_B0400       CDS       T00702                                 

Gene name
mhpF
Definition
(RefSeq) acetaldehyde dehydrogenase (EC:1.2.1.10)
  KO
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
cti  Cupriavidus taiwanensis
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RALTA_B0400 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RALTA_B0400 (mhpF)
   00650 Butanoate metabolism
    RALTA_B0400 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RALTA_B0400 (mhpF)
   00622 Xylene degradation
    RALTA_B0400 (mhpF)
   00621 Dioxin degradation
    RALTA_B0400 (mhpF)
Enzymes [BR:cti01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RALTA_B0400 (mhpF)
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     RALTA_B0400 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(444125..445030)
Genome map
AA seq 301 aa AA seqDB search
MNKIRCALIGPGNIGTDLLYKLRRSDILEPVWMVGVEPTSEGLARARELGLKTTSDGIDG
LLPHLEADDIRIAFDATSAYVHAEHSAKLTARGVRVIDLTPAAIGPFCVPPVNLAAHIGS
NEMNVNMVTCGGQATIPMVYAVSRVQPVAYGEIVATVSSRSVGPGTRRNIDEFTRTTAGA
IEAVGGARQGKAIIVINPAEPPLIMRDTIHCLTEDAPDVAAITASVHDMIAEVRKYVPGY
TLKNGPVFDGKRVSIFLEVEGLGDYLPKYAGNLDIMTASAARTAECIAAAMRAGSPETAT
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatccgatgcgccctgatcggtcccggcaatatcggcaccgacctgctctac
aagctgcgccgcagcgacatcctggaaccggtctggatggtcggcgtggagccgacctcc
gaaggcctggcgcgtgcgcgcgaactggggctgaagaccaccagcgacggcatcgacggc
ctgctgccgcacctggaggcggacgatatccgcatcgccttcgatgccacctcggcctac
gtccacgccgaacactcggccaaactgaccgcgcgcggcgtgcgcgtgatcgacctgacg
ccggcggcgatcgggccgttctgcgtgccgccggtcaacctcgccgcccatatcggcagc
aacgagatgaacgtcaacatggtcacctgcggcgggcaggccaccattccgatggtctat
gcggtgtcgcgcgtgcagccggtggcgtatggcgagatcgtggcgacggtgtcgtcgcgc
tcggtcgggcccggcacgcgccgcaatatcgacgagttcacgcgcaccaccgctggcgcg
atcgaggcggtgggcggcgcgcgccagggcaaggcgatcatcgtgatcaacccggccgag
ccgccgctgatcatgcgcgacaccatccactgcctgaccgaagacgcgcccgatgttgcc
gcgattaccgcgtcggtgcacgacatgattgccgaggtgcgcaagtacgtgcccggctac
acgctgaaaaacgggccggtgttcgacggcaagcgcgtctcgatcttcctcgaggtcgag
ggcctgggcgactacctgccgaagtacgcgggcaacctcgacatcatgaccgcctcggcc
gcgcgcaccgccgaatgcatcgccgccgccatgcgcgccggcagccctgaaaccgccact
gcctga

DBGET integrated database retrieval system