KEGG   Cupriavidus taiwanensis: RALTA_B0490Help
Entry
RALTA_B0490       CDS       T00702                                 

Definition
hypothetical protein
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
cti  Cupriavidus taiwanensis
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    RALTA_B0490
Enzymes [BR:cti01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     RALTA_B0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:529724..531424
Genome map
AA seq 566 aa AA seqDB search
MAYDAVTPVHAPLRLDDPDAHPWQAACDAVVVGFGAAGACAALEAAHGGARVIVAERFEG
GGASAKSGGVVYAGGGTPYQRAAGYDDTPQAMASYLRQETEGVVSDAMLQDFCEHSRAML
GWLEALGVRFAATVPPRKTSYPAQPYYLYYSGNEAVPAYAQHAAPAPRGHRVKGPGMSGR
TLYGVLRSAVENSRQITVMRHSAARRLILDRDGAVVGVELWQLPPGRHQKRHARLARLAE
RLHNAMPALADRLRAHLLQRELCHAQPVAVRTRAVVLATGGFIFNRAMMARHAGKYQQTW
RLGATGCDGSGIRLGESAGGATRHLERVSAWRFINPPFAWARGCVVDAQGARIGNEETYG
ATLGHAICERHGGRAWLVLNRALAPEALRECLGGRLWAFQALPAALLMLAGARRAGSIEA
LAGKLGMPGAALRATLDAYNAAARGETPDPAGKSPAMCASLEHGPWLAIDISADSRVFPC
PAITLGGLAVEESSGRVLAAAGGAPIPGLYAVGRTAVGIASNHYVSGLSLADCIWSGRNA
GRHLAQQPADGRQAHTHQETTHEPTY
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgacgccgtcacgcccgtccacgccccgttgcggctcgatgaccccgacgcg
catccctggcaggccgcctgcgatgccgtggtggtcggctttggcgcggccggggcctgc
gccgcgctcgaagccgcgcatggcggcgcgcgcgtgatcgtggcggaacgcttcgaaggc
ggcggcgccagcgccaaaagcggcggcgtggtctatgccggcggcggcacgccttaccag
cgcgccgcgggctatgacgatacgccgcaggccatggcgagctacctgcgccaggaaacg
gaaggcgtggtcagcgacgccatgctgcaggacttctgcgagcacagccgcgcgatgctc
ggatggcttgaggcgctgggcgtgcgctttgccgcgaccgtgccgccgcgcaagacctcg
tatccggcgcagccctattacctgtactactccggcaacgaagcggtgcctgcctacgcg
cagcatgccgcgcccgcgccgcgcgggcaccgcgtgaagggcccgggcatgtccggccgc
acgctgtatggcgtgctgcgcagcgccgtggaaaacagccggcagatcacggtcatgcgc
catagcgcggcgcggcggctgatcctggaccgcgacggcgcggtcgtcggcgtcgaactg
tggcagctgccgccgggccgtcaccagaagcggcatgcgcgcctggcgcggctggccgag
cggctgcacaacgccatgccggcgctggcggaccggctgcgcgcgcacctgctgcagcgg
gagctgtgccacgcccagccggtcgcggtgcgcacccgtgcggtggtgctggccaccggc
ggctttatcttcaaccgcgccatgatggcgcgtcacgccggcaagtaccagcagacctgg
cgcctgggcgcgaccggctgcgacggcagcggcatccgcctcggtgaatcggcgggcggc
gccacgcggcatctggagcgtgtgtcggcgtggcgcttcatcaatccgccgttcgcctgg
gcgcgcggctgcgtggtcgacgcgcagggcgcacgcatcggcaacgaggaaacctatggc
gccaccctcggccacgccatctgcgagcggcacggcgggcgtgcctggctggtgctgaac
cgcgcgctggcgcccgaggcgctgcgcgaatgcctgggcggccggctgtgggcgttccag
gccttgcccgcggcactgctgatgctggccggcgcgcggcgcgccggcagcatcgaggcg
ctcgccggcaagctgggcatgcccggcgccgcgctgcgcgcgactctcgatgcctataac
gccgcggcgcgcggcgagacgcccgacccggctggcaaatcgccggcgatgtgtgcgtcg
ctcgaacacgggccgtggctggccatcgacatctcggccgacagccgggtattcccgtgt
ccggcgatcacgctgggcggcctggccgtggaggaatccagcggccgggtgctggccgcc
gccggcggggcgccgatccccgggctctacgccgtgggccgcactgccgtcggcatcgcc
tccaaccactacgtaagcggcctgtcgcttgccgactgcatctggtcgggacgcaacgcg
ggccgccatctcgcacaacagcctgccgacggacggcaggcgcatacccaccaggagact
acccatgagccgacgtactga

DBGET integrated database retrieval system