KEGG   Cupriavidus taiwanensis: RALTA_B0499Help
Entry
RALTA_B0499       CDS       T00702                                 

Definition
(GenBank) putative Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00071  Fatty acid degradation
cti00280  Valine, leucine and isoleucine degradation
cti00281  Geraniol degradation
cti00310  Lysine degradation
cti00360  Phenylalanine metabolism
cti00362  Benzoate degradation
cti00380  Tryptophan metabolism
cti00410  beta-Alanine metabolism
cti00627  Aminobenzoate degradation
cti00640  Propanoate metabolism
cti00650  Butanoate metabolism
cti00903  Limonene and pinene degradation
cti00930  Caprolactam degradation
cti01100  Metabolic pathways
cti01110  Biosynthesis of secondary metabolites
cti01120  Microbial metabolism in diverse environments
cti01130  Biosynthesis of antibiotics
cti01212  Fatty acid metabolism
Module
cti_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RALTA_B0499
   00650 Butanoate metabolism
    RALTA_B0499
  Lipid metabolism
   00071 Fatty acid degradation
    RALTA_B0499
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RALTA_B0499
   00310 Lysine degradation
    RALTA_B0499
   00360 Phenylalanine metabolism
    RALTA_B0499
   00380 Tryptophan metabolism
    RALTA_B0499
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RALTA_B0499
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RALTA_B0499
   00281 Geraniol degradation
    RALTA_B0499
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RALTA_B0499
   00627 Aminobenzoate degradation
    RALTA_B0499
   00930 Caprolactam degradation
    RALTA_B0499
Enzymes [BR:cti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RALTA_B0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAP63693
UniProt: B2AIU4
Position
2:539207..540097
Genome map
AA seq 296 aa AA seqDB search
MTSPANEPISLGPNAEVLYQVADGIATVTMNRPQFHNAQNSKMTYALDEAYRRAAADDAV
KVIVLRGAGKHFSAGHDIGTPGRDINESFERASLWYDHVDKPGGEFLYAREQEVYLGMCR
RWRELPKPTIAMVHGACIAGGLMLAWVCDLIVASDDAFFADPVVRMGIPGVEYFAHAYEL
HPRIAKEFLFLGERMGAERAERMGMVNRVVPRDALEDTVYGMAAKVAQMPRLGLTLTKQA
VNHVEDLQGKRTAMDAVFAWHHFAHAHNELVSGDKLGGYDARAMAASQRTGGEDKA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgcctgccaacgaacccatcagccttggtccgaacgccgaggtgctctaccag
gtcgccgacggcatcgccacggtgacgatgaaccggccgcagttccacaacgcgcagaac
tcgaagatgacgtatgcgctggacgaggcctaccggcgcgccgccgccgacgacgcggtc
aaggtgatcgtgttgcgcggcgccggcaagcacttctcggccgggcatgacatcggcacg
ccggggcgcgacatcaacgagtcgttcgagcgcgcctcgctctggtacgaccacgtcgac
aagcccggcggcgagttcctctatgcgcgcgagcaggaggtctacctgggcatgtgccgg
cgctggcgcgagctgcccaagcccaccatcgccatggtgcatggcgcctgcatcgccggc
gggctgatgctggcgtgggtgtgcgacctgatcgtggcatcggacgatgccttctttgcc
gatccggtggtgcgcatgggaattcccggcgtcgagtacttcgcgcatgcgtatgagctg
cacccgcgcatcgccaaggaattcctgttcctgggcgaacgcatgggcgccgagcgcgca
gagcgcatgggcatggtcaaccgcgtggtgccgcgcgacgcgctcgaggacacggtctac
ggcatggccgccaaggtcgcgcagatgccgcggctggggctgacgctgaccaagcaggcg
gtcaaccacgtcgaagacctgcagggcaagcgcacggcgatggatgcagtctttgcctgg
caccacttcgcgcatgcgcacaacgaactggtcagcggcgacaagctgggcggctacgac
gcacgcgcgatggcggcgtcgcagcgcaccggcggcgaggacaaggcatga

DBGET integrated database retrieval system