KEGG   Cupriavidus taiwanensis: RALTA_B0704Help
Entry
RALTA_B0704       CDS       T00702                                 

Gene name
phoD
Definition
phosphodiesterase/alkaline phosphatase domain-containing protein (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cti  Cupriavidus taiwanensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RALTA_B0704 (phoD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RALTA_B0704 (phoD)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RALTA_B0704 (phoD)
Enzymes [BR:cti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     RALTA_B0704 (phoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(762437..764455)
Genome map
AA seq 672 aa AA seqDB search
MDRRQFLKWGSFLTVTVATGGLSACGGGDDDPAPEPDTGNPENFNFMHGVASGDPRPDSV
IVWTRVEGGNGKRPVVVRLQVSTQQDFAPPTLLVNQPLMALPDWDYTIRNKVTGLSPGTR
YFYRFLLGNRPSATGRTRTAAAPGTPLSQLRFAFVSCQDWNANHWAGMEELAQQDLDFIV
HVGDYIYEAVPGGSRAGNVEDRHTVLQLPNGTALPDGSVYATTLDDYRYLYRSYRSDARL
QALHAAFPMIAIWDDHEFSDNCWQDRQTYNIADDQTPRTARRRAASQAWFEFMPADVTLD
QNNPSFQNIQIYRAFTFGNLATLLMTDERLYRADHIIPEASVGRSIGSLYFVPTATLAAA
EAQKIAAAGNALTPVSMLGDTQRAWWQDRIGADATTWKLWGNQLSLLRMQVDVPQAVARL
IARALVLANNALASLETAIANALADDLRAARTAGTYANLAYTALRNVLVQAGIDSAAFDA
SIKPLIEARLPAITLLERFILNADQWDGFNAERKNLMAFLKTNGIRNVVALSGDIHAFFG
GQVMDDYDAAAPAPVMVDLVTAGLSSNTLLSSFRTVVDTDAAFAALRELIYSNVGGTLVN
TFDATLRAFNPWLRHADTNAEGYALVTLTPQKLSCTFHTLKPLAGGTAPALPATAGTRLL
EVAAGTADVTVT
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggaccgccgccagtttctcaagtggggaagcttcctgaccgtcaccgttgccaccggc
gggctcagcgcctgcggcggtggcgatgacgatccggcgccggaaccggataccgggaat
cccgagaacttcaacttcatgcatggcgtggcgtcgggcgatccccgtcccgacagcgtg
atcgtgtggacgcgggtggaagggggcaacggcaagcggccggtcgtggtacggctgcag
gtatcgacgcagcaggatttcgcgccgccgacgctgctggtcaaccagccgctgatggcg
ctgccggactgggactacaccatccgcaacaaggtcacgggcctgagccccggcacgcgc
tacttctaccgcttcctgctgggcaaccgccccagcgccacgggccgcacgcgcaccgcc
gccgcgccgggcacgccgctgtcacagctgcgcttcgcctttgtcagctgccaggactgg
aacgccaaccactgggccggcatggaagagctggcgcagcaggacctggacttcatcgtc
catgtcggcgactacatctacgaagccgtgccgggcggctcgcgcgccggcaacgtcgag
gaccgccacaccgtgctgcagctgcccaacggcaccgccctgccggatggcagcgtctac
gccaccacgctggacgactaccgctacctgtaccgcagctaccgcagcgacgcgcgcctg
caggcgctgcacgcggccttcccgatgatcgcgatctgggacgaccacgagttctcggac
aattgctggcaggaccgccagacctacaacatcgccgacgaccagaccccgcgcaccgcg
cgccggcgcgccgccagccaggcctggttcgagttcatgccggccgacgtgacgctggac
cagaacaacccgtcgttccagaacatacagatctaccgcgccttcaccttcggcaatctc
gccacgctgctgatgaccgacgagcgcctgtaccgcgccgaccatatcattcccgaggcc
tcggtcggccgctcgatcggcagcctgtatttcgtgccgacagcaacgctggccgcggcc
gaggcgcagaagatcgcggccgcgggcaacgcgctgacgccggtgtcgatgctgggcgac
acgcagcgcgcctggtggcaggaccgcatcggcgccgacgcgaccacgtggaagctgtgg
ggcaaccagctctcgctgctgcgcatgcaggtggacgtgccgcaggcggtggcgcggctg
atcgcacgggcgctggtgctggccaacaacgcgctggcctcgctagagacggcaatcgcc
aatgcactggccgacgacctgcgcgcggcgcgcaccgccggcacctatgccaacctcgcc
tataccgcgctgcgcaacgtgctggtacaggccggcatcgacagcgccgcgttcgacgcc
agcatcaagccgctgatcgaggcccggctgccggcgattacgctgctcgagcgctttatc
ctcaatgccgaccagtgggatggcttcaacgccgaacgcaagaacctgatggcgttcctg
aagaccaacggcatccgcaacgtggtagcgctgagcggcgatatccacgcgttcttcggc
ggacaggtgatggacgactacgatgccgccgctccggcgccggtgatggtggacctggtc
acggcggggctgtcgagcaacacgctgctcagttccttccgcaccgtagtcgataccgac
gcggcctttgccgcgctgcgcgagctgatctacagcaacgtcggcggcaccctcgtcaat
accttcgatgccacgctgcgcgccttcaacccgtggctgcgccatgccgacaccaatgcc
gagggctatgcgctggtcacgctgacgccgcagaagctgagctgcaccttccacaccctg
aagccgctcgccggcggcacggcgccggcgctgccggccaccgccggcacgcggctgctg
gaagtagcggcaggcacggccgatgtgaccgtgacctag

DBGET integrated database retrieval system