KEGG   Cupriavidus taiwanensis: RALTA_B0791Help
Entry
RALTA_B0791       CDS       T00702                                 

Definition
chemotaxis protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cti  Cupriavidus taiwanensis
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cti02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cti02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:848566..849516
Genome map
AA seq 316 aa AA seqDB search
MVGTSSGGVDALRELAAGLPAGFDAAILVVLHIGANPSMLPQMLARAGPLPAHHARNGEA
VLPGVIYVAPPDHHLMIDGERTVLRRGPKENFARPAIDPLFRSAAVTRRSRVVGAILTGQ
LDDGTAGLQAVHQCGGITIVQDPDSAYAPDMPRNALSAVSPDFVLPLAAIAPQLAQLAGT
TAHPAPEPPPSLLLEYAMSVGPTSVEAVKQIALPSALTCPECGGTLWEMRGVVPPRFRCH
TGHTFGLSTLRDACKNALEHTLYDALRALHEQNELYTRIAAYYMQTGDVDVARQYTDAAG
RAAASAKRIEGWLRES
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggtacctcctccgggggcgtcgacgccttgcgcgaactcgcggccggtctgccg
gccggcttcgacgccgccatcctggtggtgctgcacatcggcgcgaatcccagcatgctg
ccgcagatgctggcccgggccgggcccttgccggcgcaccacgcgcgcaatggcgaagcg
gtactaccgggggtcatctatgtcgcgccgcccgaccatcatctgatgatcgacggcgaa
cgcaccgtgctgcggcggggcccgaaggagaacttcgcacgtcccgccatcgacccgttg
ttccgcagcgccgcggtgacccggcgcagccgtgtagtgggagcaatcctgaccggtcag
ctcgacgatggcaccgcgggcttgcaggcggtgcaccagtgcggcgggatcaccatcgtc
caggaccccgacagtgcctatgcgccggacatgccgcgcaatgcgctgagcgccgtttct
cccgatttcgtactgccgctggctgccattgccccgcagctcgctcagctggcgggaaca
acggcccatccggcgcccgagccgccaccgtcgctgctgctggaatatgccatgtcggtg
ggcccgacctcggtcgaggcggtgaagcagattgcgctgccttcggcgctcacctgcccg
gagtgtggcggcacgctgtgggagatgcgcggcgtggtgccgccccgcttccgctgccac
actggccacactttcgggctttccacgctgcgcgatgcgtgcaagaacgcgctggagcac
acgctttacgatgccttgcgtgccctgcacgagcagaatgaactttatacacgtattgcg
gcgtattatatgcaaacgggggacgttgacgttgcccgtcagtacaccgacgcagctggc
cgcgcagcagcgtccgcgaagcgcatagaaggctggcttcgcgagagctag

DBGET integrated database retrieval system