KEGG   Cupriavidus taiwanensis: RALTA_B1368Help
Entry
RALTA_B1368       CDS       T00702                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cti  Cupriavidus taiwanensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RALTA_B1368 (malQ)
Enzymes [BR:cti01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     RALTA_B1368 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1466653..1468896
Genome map
AA seq 747 aa AA seqDB search
MSRARPHSPLQALAVRAGLLPHWTDAWDQPREVSDAALRRVLDGLGLPCGSPGQCAASHA
WLAADDAAHALPPLVTAERGQPVAVPWPHTLPQRAYRLTLEDGAIISGTAVRASGAGTAL
MQLPAVDVCGYHRLDLGDGHTTLAVAPRRCYGVADAVRHAGRDRDDTRATPWGLAVQLYS
LRRGAPCGMGDLTALAEACASAARAGADAIAINPLHAPFAALPGRYSPYAPSSRLFLNPL
YADPATLFGQAAVDAAIAGVGAGDTLQALEARGEIDWIALAPLRYAILRWLWQRRETLLS
RAALDDCAAFRARGGTALHAHACYEAIQAQRLGDSANANNHHAAPDWRSWPVTLRSPADA
AVAAFAQAHADEVAFHAFLQWLADDGLARAQRAARDAGMAVGLIRDLAVGADPGGSQAWT
RQPETLAGFHAGAPPDLYNPLGQDWGVAVFSPRGLRRHGYGAFLEMLRANLSHAGGLRID
HVLGLARMWLVPAGAPASDGAYLRYPLEDLLRLVALESWRHRAIIIGENLGTVPPELNAA
LSARGVLGIDVLWFQREARAQADAGDGALAADAGPPGAQAPATAAFLPPRAWPPDAVATT
TTHDLPTVAGWWAGQDLAWRDRLRLLASGETLAQAQAERARERVALWQALCEAGLCSGAV
PAPEHAPLDAVLAWVGTAPTAMRLLPVEDLLGLAEQPNLPGTTSVHPNWQRRLDTEVRAW
FGTPTLRARADAWRGGRRGARPPPARR
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgctcgcccgcactcgccgctgcaggcgctggccgtgcgcgcaggcctgctg
ccgcactggaccgatgcgtgggaccagccccgcgaggtcagtgacgcggccctgcggcgc
gtgctggacggcctgggcctgccgtgcggcagccccggccagtgcgccgcctcgcacgcc
tggctggccgccgacgacgccgcccatgcgctgccgccgctggtgaccgccgaacgtggc
cagccggtggcagtgccgtggccgcataccttgccgcaacgcgcctaccggctgacgctg
gaggacggcgcgatcatctccggtaccgcggtgcgcgccagcggggccggcaccgcgctg
atgcaattgcccgccgtcgacgtctgcggctatcaccggctggacctgggcgatggccat
accacgctggcggtggcgccgcggcgctgctacggcgtcgccgacgccgtgcggcatgcc
ggccgcgaccgcgacgacacgcgcgccacgccgtggggcctggcggtgcagctctacagc
ctgcggcgcggcgcgccttgcggcatgggcgacctgaccgcgctggccgaggcctgcgcc
agcgccgcgcgcgcaggcgccgacgccatcgccatcaacccgctgcatgcgcccttcgcc
gcgctgcccgggcgctacagcccctatgcgccttccagccggctgttcctgaaccccctc
tatgccgacccggccacgctgttcggccaggcggccgtggatgccgccatcgccggcgtg
ggcgcgggcgacaccctgcaggcgctcgaggcccgcggcgagatcgactggatcgcgctg
gcgccgctgcgctacgccatcctgcgctggctgtggcaacgccgcgaaaccctgctttcg
cgggccgcgctggatgactgcgccgcctttcgcgcgcgcggcggcacggcgctgcacgcg
catgcctgctatgaggcgatccaggcgcagcgtctcggcgacagcgccaatgccaacaac
caccatgccgcgccggactggcgcagctggcccgtcacgctgcgctcgccggcggatgcc
gcggtggccgccttcgcgcaggcgcacgccgacgaggtcgccttccatgcgttcctgcaa
tggctggccgacgatggcctggcgcgggcgcagcgcgcggcgcgggacgccggcatggcc
gtggggctcatccgcgacctcgccgtcggcgccgaccccggcggcagccaggcatggacg
cggcagccagaaacgctggccggcttccatgccggcgcaccgcccgacttgtacaacccg
ctgggccaggactggggcgtggcggtgttctcgccgcgcgggctgcgccggcacggctac
ggggcgttcctcgagatgctgcgcgcgaacctgtcgcacgccggcggactgcgtatcgac
cacgtgctgggcctggcgcggatgtggctggtgcctgccggcgcgcccgccagcgacggc
gcttacctgcgctatccgctggaagacctgctgcggctggtggcgctggagtcgtggcgg
catcgcgccatcatcatcggcgagaatctcggcacggtcccgcccgagctgaatgcggca
ctgtcggcgcgcggcgtgctcggcatcgacgtgctgtggttccagcgcgaagcgcgcgcg
caggcagacgccggggacggcgcactggcagccgacgccggcccgccgggcgcgcaggcg
cccgcgacagcggccttcctgccgccgcgggcatggcccccggatgccgtcgccaccacc
accacgcacgacctgcccaccgtcgccggctggtgggccggccaggacctggcgtggcgc
gaccggctacgactgctggcatccggcgaaaccctggcgcaggcgcaggccgagcgcgcg
cgcgagcgcgtggcgctatggcaggcgctgtgcgaggccggattatgcagcggcgccgtg
cccgcgccggaacatgcgccgctagacgcggtgctcgcctgggtgggcacggcccccacg
gccatgcggctgctgccggtcgaggacctgctggggctggccgagcagcccaacctgccc
ggcacgaccagcgtgcatcccaactggcagcgccggctcgataccgaggtgcgtgcgtgg
ttcggcaccccgacgctgcgcgcgcgcgccgacgcgtggcgcggcggccgccgtggcgcc
cggcctccgccggcgcgcaggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system