KEGG   Cupriavidus taiwanensis: RALTA_B1670Help
Entry
RALTA_B1670       CDS       T00702                                 

Definition
GTP cyclohydrolase i (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cti  Cupriavidus taiwanensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RALTA_B1670
Enzymes [BR:cti01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     RALTA_B1670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1796937..1797683
Genome map
AA seq 248 aa AA seqDB search
MTTKDAAHRAQDSNAGDSASHPAGSVSARIRARLEAAQERFHANDNIARYIEPGEMEQLQ
AEVQARLQDVLRALVIDVDNDHNTQETARRVAKMYLKEIFAGRYAKAPPVTEFPNVGQLN
ELMIVGPLRVRSACSHHLCPIIGKLWIGVMPNQHSNLIGLSKYARLAEWIMCRPQIQEEA
VAQVADLLQEKMSPDGLAIVMEAEHFCMHWRGVRDTDAKMTNSVMRGSFLKDDSLRREFL
TLLNHNRG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaaggacgccgcgcaccgcgcacaggacagcaacgccggcgacagtgccagc
catcccgccggcagcgtctcggcccgcatccgcgcgcggctggaagccgcgcaggagcgc
ttccatgccaacgacaatatcgcccgctacatcgagcccggcgaaatggaacaactgcag
gccgaagtccaggcccggctgcaggacgtgctgcgggcgctggtcatcgacgtcgacaac
gaccacaacacgcaggaaaccgcgcgccgcgtggccaagatgtacctgaaggaaatcttc
gccgggcgctatgccaaggccccgccggtgacggaattccccaacgtcggccagcttaac
gaactgatgatcgtcgggccgctgcgcgtgcgcagcgcctgctcgcaccacctgtgcccg
atcatcggcaagctgtggatcggggtgatgccgaaccagcattccaacctgatcgggctg
tccaagtacgcgcgcctggccgaatggatcatgtgccgaccgcagatccaggaagaggcg
gtggcgcaggtggccgacctgctgcaggaaaagatgagtccggacggcctggccatcgtg
atggaggccgagcacttctgcatgcattggcgcggcgtgcgcgacaccgacgccaagatg
accaacagcgtgatgcgcggctcgttcctgaaggacgacagcctgcgccgcgaattcctc
acgctgctgaaccataaccgcggctag

DBGET integrated database retrieval system