KEGG   Cupriavidus taiwanensis: RALTA_B1768Help
Entry
RALTA_B1768       CDS       T00702                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
cti  Cupriavidus taiwanensis
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cti02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1903134..1904171
Genome map
AA seq 345 aa AA seqDB search
MKIGIVNDSPLAVAALRRALALDPSFEIAWIAGDGAQAVQMAARQTPDLILMDLLMPVMD
GVEATRRIMADTPCAIVVVTMDLGRNASQVFDAMGHGAIDAVDTPTLAEADAQLAAGPLL
RKLRNIARLLAGRVAPQHALAAAPRAGSAPRLVAIGASAGGPAALATLLGALPADLGAAV
VTVQHVDEAFAAGMAEWLDGQCALPVRIARAGETPQAGTVLLAGTNDHLRLASPTRLAYT
EQPCDYLYRPSIDVFFESVVEHWRGDVIGVLLTGMGRDGALGLKAMRDRGFLTIAQDRAT
SAVYGMPKAAAALGAAAEILPLPRIAPRLVQACGLAALPWPAPPA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggcatcgtcaatgattccccgctcgcggtggccgcgctgcgccgcgcgctg
gcgctggatccgtcgttcgagatcgcgtggattgccggcgacggcgcccaggcggtgcag
atggccgcgcgccagaccccggacctgatcctgatggacctgctgatgccggtcatggac
ggcgtcgaggccacgcgccggatcatggccgacacgccctgcgccatcgtggtggtgacc
atggacctgggacgcaacgcctcgcaggtcttcgacgccatggggcacggcgccatcgac
gcggtcgacacgccgacgctggccgaggccgatgcacagctcgccgccgggccgctgctg
cgcaagctgcgcaatatcgctcggctgctggccggccgggtggcaccgcagcacgcgctg
gcggcggcgccgcgcgccggcagcgcgccgcggctggtggcgatcggcgcctcggccggc
ggcccggcggcgctggccacgctgctgggcgcgctgccggcggaccttggcgccgcggtg
gtcaccgtgcagcatgtcgacgaggcctttgccgccggcatggccgagtggctcgacgga
cagtgcgcgctgccggtgcgcatcgcccgcgccggcgagaccccgcaggccggcaccgtg
ctgctggccgggaccaacgaccacctgcgcctggccagcccgacccggctggcctatacc
gaacagccctgcgactacctttaccgcccttccatcgacgtcttcttcgaaagtgtggtg
gaacactggcgcggcgacgtgatcggcgtgctgctcaccggcatgggacgcgacggcgcg
ctgggcctgaaggccatgcgcgaccgcggcttcctcaccatcgcccaggaccgcgcgacc
agcgccgtgtacggcatgcccaaggccgccgccgcgctcggcgccgccgccgagatcctg
ccgctgccgcgcatcgcgccgcggctggtgcaggcgtgcggcctcgcggccctgccgtgg
ccggcgccgcctgcctga

DBGET integrated database retrieval system