KEGG   Cupriavidus taiwanensis: RALTA_B1800Help
Entry
RALTA_B1800       CDS       T00702                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent enzyme, beta family; threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cti  Cupriavidus taiwanensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RALTA_B1800
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RALTA_B1800
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RALTA_B1800
Enzymes [BR:cti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RALTA_B1800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1939661..1940833)
Genome map
AA seq 390 aa AA seqDB search
MRASRHPSPAKPLSNPAMQVLRCITCETSYPIADMPEGCPACADAGRPSSLEVVYDTQAL
DFAPKSGSYIWGHWQPYLHGVSLGEGATPCVLVPALASLAGVASVWIKNEGANPTGSHKD
RMSAQAISRALDMGAREVVLASSGNAAVSAAAYCAAAGLECEVATYQALPAVFDAALRHY
GARRVVCDDGHARWAHVRRRVRQDGAFALTNYSVPAVGSPVFGVEGYRAVALEWVAQGCR
PDHVVVPTARGDLLWGIYSALRDLVALGHLSTLPRLWAVEPFPRLSRVLAGASQQADFAG
TTRQFSTAGSTVTAQQVLAVRRSGGGAVVIDDAAARAGTRHLAAAGFWVELCAGAGFAAA
QALRADGRIDKTESVMLMLTARGDRDPGQA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccagccgccatccgtctccggcgaaaccgctctccaatccggcaatgcaagtg
ctgcgatgcatcacatgcgagaccagctacccgattgccgatatgccggaaggctgcccg
gcctgcgcggacgccggccggccaagcagtctcgaagtggtctacgacactcaggcactg
gattttgcaccgaaaagcggaagttatatatggggccattggcaaccctacctgcacggc
gtgtccctgggcgagggcgccacgccatgcgtcctggtgccggccctggcgtcgctggcg
ggcgtggcgtcggtctggatcaagaatgaaggcgctaaccccaccggctcgcacaaggac
cgcatgtcggcgcaagccattagccgggcactggacatgggcgcgcgcgaggtagtgctg
gcgtccagcggcaacgccgcggtctcggccgcggcctattgcgccgccgccggactggag
tgcgaagtcgcgacttaccaggcgctgccagcagtgtttgacgcggcgctgcgccactac
ggcgcacggcgcgtggtctgcgatgacggccatgcgcgctgggcgcatgtgcgccggcgc
gtccggcaggacggtgcgtttgcgctgaccaactacagcgtgcccgcggtaggcagcccc
gtattcggcgtggagggctaccgggctgtcgcgctcgagtgggtcgcgcaagggtgccga
cccgaccatgtcgtcgtgccaaccgcacgcggcgacctgctgtggggcatctacagtgcg
ttgcgggacctggtcgcgctggggcacctgtcgacactgccgcgcctctgggcggtcgag
ccgtttccgcggctgtcacgggtgctggcgggcgcgtcgcagcaggccgacttcgctggc
acaacgcggcaattttccacggcaggctcgaccgtgacggcccagcaggtcctggccgtc
aggcgctcgggcggcggcgctgtggttatcgacgacgccgcggcacgcgccggcacgcgc
catctcgccgccgcgggattctgggtggagctgtgcgccggcgcaggcttcgccgcggcg
caggcattacgcgccgacgggcgcatcgacaagaccgaatccgtgatgctgatgctgacc
gcgcgcggcgaccgggatcccggacaagcatga

DBGET integrated database retrieval system