KEGG   Cupriavidus taiwanensis: RALTA_B2011Help
Entry
RALTA_B2011       CDS       T00702                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit e2 (EC:2.3.1.-)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cti  Cupriavidus taiwanensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:cti01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cti00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cti00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cti00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2188119..2189237
Genome map
AA seq 372 aa AA seqDB search
MRVFKLPDLGEGLQEAEIVAWHVKTGDTVAADQPLLSVETAKAIVEIPSPYAGSIGKLFA
QPGDIVHLGAPLVGFEGAGEDADAGTVVGSVQVGTHVASEAAPPGTAAPAAGMAARIKAT
PAVRALARRLGVDLAMATASGPEGVVTAADVERVAATLKDLGAPEELRGVRRAMAQNMAR
AQAEVAAATVMDDADIHAWPAGADVTIRLVRALVAGCRAEPGLNAWYEGQTGRRHVLKKI
DVGIAADLPEGLFVPVLRDVGNRDAADLRHGLDRMRADIRARTIAPEEMRGNTITLSNFG
MIAGRYAAPIVVPPTVAILGAGRVRDAVVAAGGVPAVHRVMPLSLTFDHRVVTGGEAARF
LAAVIADLEMAE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcttcaagctgcccgacctgggcgaaggcctgcaggaggccgagatcgtggcc
tggcacgtcaagaccggcgacacggtcgcggcggaccagccgctgctgtcggtggagacc
gccaaggcgatcgtcgaaatcccgtcgccttatgccggcagcatcggcaagctgtttgcg
cagccgggcgacatcgtgcacctgggcgcgccgctggtgggtttcgagggcgccggcgaa
gatgccgacgccggcaccgtggtgggctcggtccaggtcggcacgcacgtggccagcgaa
gccgcgccgcccggcaccgccgcgcccgctgcggggatggccgcgcgcatcaaggcgacg
ccggcggtccgtgcgctggcgcgccggctcggcgtggacctggccatggccaccgcctcg
ggtcccgagggcgtggtcaccgccgccgacgtggaacgggtcgccgccacgctgaaggac
ctcggcgcgcccgaagaactgcgcggcgtgcgccgcgcgatggcgcagaacatggcgcgt
gcgcaggccgaagtcgccgccgctaccgtgatggacgatgccgacatccacgcctggccg
gccggcgccgatgtcaccatccggctggtgcgcgcgctggtggccggctgccgcgccgaa
ccggggctcaatgcgtggtatgaaggacaaaccggacgccgccacgtgctgaagaagatc
gacgtcggcattgccgccgacctgcccgagggcctgttcgtgccggtgctgcgcgatgtc
ggcaaccgcgacgccgccgacctgcgccacgggctcgaccgcatgcgcgccgacatccgc
gcgcgcaccatcgcccccgaggagatgcgcggcaacaccatcacgctgtccaacttcggc
atgatcgccgggcgctatgcggcgccgatcgtggtgccgcccaccgtggcgatcctgggt
gccgggcgcgtgcgcgacgcagtggtcgcggccggcggcgtgcccgcggtgcaccgggtc
atgccgctgagcctgaccttcgaccaccgcgtggtgacgggcggagaggccgcgcgcttc
ctggcggcggtgatcgcggatctggagatggcggagtaa

DBGET integrated database retrieval system