KEGG   Cupriavidus taiwanensis: RALTA_B2084Help
Entry
RALTA_B2084       CDS       T00702                                 

Gene name
cycA
Definition
cyochrome C2
Orthology
K08738  
cytochrome c
Organism
cti  Cupriavidus taiwanensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RALTA_B2084 (cycA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RALTA_B2084 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2258335..2258709)
Genome map
AA seq 124 aa AA seqDB search
MRRTAATLLALTFSTAIPTAAAADLQAGKALFATRCASCHHVGRNARAGFGPQLNGIFGR
TAGSTKDFQYSDAMRTSKVVWSHDTLRAFVRSPGKVVPGTKMRFWGLGDDQQITDLLAYL
ETFK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgtaccgccgccacgctgctggcactgaccttttccaccgccattcccaccgcc
gccgccgccgatctccaggccggcaaggccttgtttgcgacgcgctgcgcttcatgccac
cacgtcggtcgcaatgcgcgcgcgggctttggcccgcagctgaacggcatcttcggccgc
acggccggcagcaccaaggatttccagtattccgacgcgatgcgcacatcgaaggtggtg
tggtcgcacgacacgctgcgcgctttcgtccgttcgcccggcaaggtggtgccgggcacg
aagatgcggttctggggactgggcgacgatcagcagatcaccgatctgctggcgtacctc
gagaccttcaagtaa

DBGET integrated database retrieval system