KEGG   Cupriavidus taiwanensis: RALTA_B2084Help
Entry
RALTA_B2084       CDS       T00702                                 

Gene name
cycA
Definition
(GenBank) Cytochrome c2 precursor
  KO
K08738  cytochrome c
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00920  Sulfur metabolism
cti01100  Metabolic pathways
cti01120  Microbial metabolism in diverse environments
cti02020  Two-component system
Module
cti_M00595  Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RALTA_B2084 (cycA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RALTA_B2084 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: CAQ72661
UniProt: B3RCN6
Position
2:complement(2258335..2258709)
Genome map
AA seq 124 aa AA seqDB search
MRRTAATLLALTFSTAIPTAAAADLQAGKALFATRCASCHHVGRNARAGFGPQLNGIFGR
TAGSTKDFQYSDAMRTSKVVWSHDTLRAFVRSPGKVVPGTKMRFWGLGDDQQITDLLAYL
ETFK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgtaccgccgccacgctgctggcactgaccttttccaccgccattcccaccgcc
gccgccgccgatctccaggccggcaaggccttgtttgcgacgcgctgcgcttcatgccac
cacgtcggtcgcaatgcgcgcgcgggctttggcccgcagctgaacggcatcttcggccgc
acggccggcagcaccaaggatttccagtattccgacgcgatgcgcacatcgaaggtggtg
tggtcgcacgacacgctgcgcgctttcgtccgttcgcccggcaaggtggtgccgggcacg
aagatgcggttctggggactgggcgacgatcagcagatcaccgatctgctggcgtacctc
gagaccttcaagtaa

DBGET integrated database retrieval system