KEGG   Cupriavidus taiwanensis: RALTA_B2294Help
Entry
RALTA_B2294       CDS       T00702                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cti  Cupriavidus taiwanensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RALTA_B2294 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RALTA_B2294 (glk)
   00052 Galactose metabolism
    RALTA_B2294 (glk)
   00500 Starch and sucrose metabolism
    RALTA_B2294 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    RALTA_B2294 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RALTA_B2294 (glk)
   00524 Butirosin and neomycin biosynthesis
    RALTA_B2294 (glk)
Enzymes [BR:cti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RALTA_B2294 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2480404..2481414)
Genome map
AA seq 336 aa AA seqDB search
MATTASFSADFPRLLGDVGGTNVRFALETAPMRIGPVTALKVSDFPSLEAALRQYLDGLA
GAGQPTPRHAAIGLANPVTGDQVRLTNHNWTFSIDGMRRALGLQTLVAINDFTALALALP
HLPADSLAQVRAGTAVRTAPLALVGPGTGLGVSGLVPAPGGQTVALAGEGGHIELMPDTD
DEWIAWRAAHRNVGRVSAERLLSGSGLSHIHAALAAETGTLLLAPLQPAQVTAGAFERND
PLCQRAMAVFFGLLGSVAADIALVIGARGGVYLGGGILPRFVPALRDSVFAERFVAKGRM
RGWLEAVPVHVITASHPALPGLAHALAERLGGARNG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggctactaccgcatccttctccgctgacttcccgcgcctgctcggcgatgtaggcggc
accaacgtgcgctttgcgctggagaccgcgcccatgcggatcgggccggtgacggcgctg
aaggtgtccgatttcccgtcgctcgaggccgcgctgcgccagtacctcgacggcctggcc
ggcgcgggccagcccacgccgcgccacgcggcgatcggcctggccaatcccgtgaccggc
gaccaggtccggctgaccaatcacaactggaccttctcgatcgacggcatgcggcgcgcg
ctgggactgcagacgctggtggccatcaacgacttcaccgcgctggcgctggcgctgccg
cacctgcccgccgacagcctggcgcaggtgcgcgccggcactgccgtgcgcaccgcgccg
ctggcgctggtcgggcccggcaccgggctgggcgtttccggactggtgccggcaccgggc
gggcagaccgtggcgctggccggcgaagggggccatatcgagctgatgccggacaccgac
gacgaatggatcgcgtggcgcgcggcccatcgcaacgtcggccgggtctcggccgagcgg
ctgctgagcggcagcgggctgtcgcatatccatgccgcgctggccgcagaaacgggtacg
cttttgctcgcgccgctgcagccggcgcaggtcaccgcgggcgccttcgagcgcaacgac
ccgctgtgccagcgcgccatggcggtgttcttcgggctgctgggctcggttgcggccgat
atcgcgctggtgatcggtgcgcgcggcggcgtttatctgggcggcggtatcctgccgcgc
ttcgtgccggcgctgcgggactcggtattcgccgagcgctttgtcgccaagggccgcatg
cgcggctggctcgaggcggtgccggtccatgtcatcaccgccagccatccggcgctgccc
gggctggcgcatgcgctggccgagcgccttggcggcgcgaggaacggttag

DBGET integrated database retrieval system