KEGG   Cupriavidus taiwanensis: pRALTA_0002Help
Entry
pRALTA_0002       CDS       T00702                                 

Definition
Type III restriction enzyme (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
cti  Cupriavidus taiwanensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRALTA:2091..5081
Genome map
AA seq 996 aa AA seqDB search
MKLKFDSTLEYQHDAFNAVTDLFEGMAFSQDSHSVTLGTETMFGGEHAELGIGNIMPLAP
TQFLANLQSVQARNNVPKSRALIEEGGPYDFPNFSIEMETGTGKTYVYLRTVFELNRLYG
FRKFVVVVPSVAIREGVTTSLVLMRDHFRDLYDNVAFDSFVYNSRDLSRVRQFAVNNEIQ
IMVINIQAFAKDAEKAGNVIHQEQDRMSGRKPIDFVRATNPIVIIDEPQSVDTTAKSQKA
IAGLNPLLCLRYSATHVHPYNLLYQLDPIRAYDLRLVKQIEVVDANPVRDFNRTMVRLDW
IGYPGRAKTPQAKVTVFEDTSNGPREKPVTLKHGADLSLFTNRSDYEGYQVTNISAEPGS
EYIEFGNGQILELSRETGGMADERMKNQIRQTVEEHFAKEKKFKALGIKVLSLFFLDQVG
SYRQYDDEGNRCNGKVSQWFEEIYAEVAAKSIYQGVLTYSAEQVHDGYFSADRRKGKVVT
LLDTSGSTAKDDETYELIMKDKERLLDPEEPLRFIFSHSALKEGWDNPNVFQICTLREMG
TENERRQTLGRGLRLPVNKDGDRIFNEQINRLTVIANESFQDYAKGLQADIEKAIDPDGS
FRFGRVPKLAFTPLLNPEGTAQLTEEQSEAIWKHLVSKGFLDRNGDFESAFKPNSEGFTL
NLPLDFSAEGFEAAVVGRLNRFVPRDFVKDARMRESVKYNKRVELNPEFQILWEKISRKT
RYSVEFQTDELIAKAILKMRDMPEIKAVRIEVTKRSVDITEAGVDGGLVTSNRTYVVANE
QPLPDILAFLQRETELTRGTLVRILKDCGQLNYFGINPQAFMTECAKLINRALHELIVDG
IKYEPIAGQAYEMRLFEEAEVEEYLDRLYAVKEKAGILPDGTEVPRTPYDWISFDSEVER
TVAERLDGDPQVKFFCKLPRGFKVPTPIGNYNPDWAIVLEDDGKLYLVRETKSTLDSDKL
RDSENRRIKCGKAHFKALGVDFKAATNIHEVLTGAA
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcaaatttgactcaacgctggagtaccagcacgacgcgttcaacgccgtaacg
gacctgttcgagggaatggcgttcagccaggatagccattccgtcacgctcggaacggaa
acgatgttcggcggcgaacatgccgagcttgggatcggcaacataatgccgttggctccg
acgcaatttcttgcaaacttgcagtctgtccaagcacgcaacaacgttccgaaatcccga
gccttgatcgaagaaggcggcccgtacgatttcccgaatttctccattgaaatggagacc
ggtaccgggaagacctacgtctacctgcgcactgtgtttgaattgaaccgcctctatggt
ttccggaaattcgtcgtcgtcgtcccgtcagtcgcgattcgcgaaggcgtcacgacttct
ctcgtgctgatgcgggaccacttccgagatttgtatgacaacgtcgcgttcgacagcttc
gtgtacaactcgagggatctgagccgcgtccggcagttcgccgtaaacaacgagatccag
atcatggtgatcaatatccaagccttcgcgaaggatgcggaaaaagctggaaatgtgatc
catcaggagcaagatcgaatgtcgggccgcaagccgatcgacttcgtgcgggcaacgaac
ccgatagtcataattgacgagccgcagagcgtcgataccaccgcgaaatcccaaaaagcg
atcgctggactaaatccgctcctctgcctgcgctactcggcgacgcacgtccacccgtac
aacctgctctaccagctcgacccgattcgggcatatgacctccggctagtcaagcaaatc
gaagtcgtggatgcgaatcccgtacgggacttcaaccggacgatggtccgcctcgactgg
attggttatccgggaagggccaaaacgcctcaggccaaggtcacggttttcgaagatacc
tcgaacggaccgcgggagaaaccagtcacgctcaagcacggcgcggatttatccttgttc
acaaaccgctccgactacgaggggtatcaggtcaccaacatcagcgccgaaccgggaagc
gagtatatcgaatttggaaatgggcagatcctcgagctatcgcgggaaacggggggcatg
gccgacgagcgcatgaagaatcagattcgacaaaccgtcgaagagcacttcgccaaagag
aagaaatttaaggcgctcgggatcaaggtcctgtcgctgttcttcctcgaccaggtcggc
agctaccgccagtatgacgacgaagggaaccggtgcaatggaaaggtctctcagtggttc
gaagagatctatgcagaggtcgctgccaagtcaatttaccagggcgtgctcacctactca
gccgagcaggttcacgacggctacttctcggcagaccgcaggaagggcaaggtcgtcaca
cttctggacacgagcggcagcaccgccaaggatgacgagacgtacgagctgatcatgaag
gacaaagaacggctgctcgacccggaggagccactccgcttcatcttcagtcattcggca
ctcaaagaaggctgggataacccgaacgtctttcagatctgcacactccgggagatggga
actgaaaatgaacgccgccagacgctcggccgcggacttcgccttcccgtcaacaaagac
ggggaccggatcttcaacgaacagatcaaccgcttgacggtcatcgcgaacgagtctttt
caagactacgccaagggccttcaggccgacattgaaaaggccatcgacccggacggaagt
ttccgttttggtcgggttccgaaactggcgttcactcctctgctcaacccggaaggaact
gcccaactcaccgaggagcaatccgaggcaatctggaagcaccttgtgtccaaagggttc
ctcgaccgaaacggcgacttcgaaagtgccttcaagccgaattctgaaggcttcaccctg
aatctacccctggatttttccgccgagggattcgaggctgccgtggtaggccgtctcaac
cgattcgtcccccgcgacttcgttaaggacgcccgaatgcgcgagtcagtcaagtacaac
aagcgggtcgaactcaatcccgagttccagattctctgggaaaagatcagtcggaaaact
cgctactcggtggaattccaaaccgacgagctgatcgcgaaggctatcttaaagatgcga
gacatgcctgagatcaaggccgtccggatagaagtcacgaaacgatcagtcgacatcacc
gaagccggggtggacggcgggctcgtgacgagcaaccgcacatatgtcgtggccaacgag
cagccgcttccggacatacttgcattccttcaacgcgaaaccgagctcacgcgcggaacg
ctcgtacgtatccttaaggattgcggacaactcaactacttcgggataaatccgcaggcc
ttcatgacggaatgcgccaagctaatcaaccgagccctccacgaacttattgttgacggg
atcaagtacgagccgattgccggtcaggcatacgaaatgcgcctgtttgaagaggcagaa
gttgaggaatacctcgacaggctgtacgcggtgaaagaaaaggccggaattctcccggac
ggcaccgaagtgccaaggacgccgtatgactggatttctttcgattcggaagtggagcgg
acggtggccgaacggctcgacggggatccccaagtaaagttcttttgcaagctcccgcgg
ggattcaaggttccgacgccgatcggcaactacaaccccgactgggcgatcgtcctcgag
gacgatgggaaactttaccttgtccgcgaaacgaagagcacgctcgattccgacaagctc
cgcgacagtgagaaccggagaataaagtgtggtaaagcacacttcaaggcgctcggcgtt
gacttcaaggcggcgacgaacatccatgaggtactgactggagctgcctaa

DBGET integrated database retrieval system