KEGG   Chlamydia trachomatis B/Jali20/OT: JALI_0301Help
Entry
JALI_0301         CDS       T00960                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ctj  Chlamydia trachomatis B/Jali20/OT
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ctj00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
34391..35008
Genome map
AA seq 205 aa AA seqDB search
MSVKVISPFSQDGVQCFPKLFIISAPAGAGKTTLTHMLQREFPDAFEKTVSSTTRSARPG
EVHGVDYLFVSEDDFKQSLDREDFLEWVFLFGTYYGTSKAEISRVLQKGKHCIAVIDVQG
ALALKKQMPAVTIFIQAPSQEELERRLNARDSEKDFQKKERLEHSAVEIAAASEFDYVVV
NDDLITAYQVFRSIFIAEEHRMSHG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaaaggttatttcccccttttctcaagacggggttcaatgctttcccaagctt
tttatcattagcgctcctgctggagcagggaagacaacactcacccatatgctacaaaga
gagtttcctgatgcatttgagaagacggtgtcgtcaacgacacgttcggctcgtccaggc
gaagtgcatggcgtggattatttgtttgtatctgaagatgactttaagcaatctttagat
agggaagattttttggaatgggtctttttatttgggacttattacggaacgagtaaggcg
gagatttctagagttctgcaaaagggtaagcactgtatagccgtgattgatgtacaagga
gctttggctctgaagaagcaaatgccggcagtcactatttttattcaagctccctctcaa
gaagaacttgagcgccgtttgaatgctcgggattcagagaaagatttccagaagaaagaa
agattagagcatagcgctgtcgaaattgctgccgctagcgaatttgattatgttgtggtt
aatgatgatttgattacagcatatcaagttttcagaagtatttttatagctgaagaacat
aggatgagtcatggctag

DBGET integrated database retrieval system