KEGG   Chlamydia trachomatis B/Jali20/OT: JALI_0541Help
Entry
JALI_0541         CDS       T00960                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ctj  Chlamydia trachomatis B/Jali20/OT
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ctj01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ctj00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ctj00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64275..65375
Genome map
AA seq 366 aa AA seqDB search
MSIEVRIPNIAESISEVTISALLIPSGDLVQENQGILEIESDKVNQLIYAPCSGKVEWSV
SVGDTVAVGSVVGIISEAEKSQDTAPIHEQMPFSLVEQESDAQIIAFPSSVRQDPPAEGK
TFVPLKEIQPAASSDHRESRESMSAIRKTISRRLVQSLHDSAMLTTFNEIHMGPLIALRK
ERQEDFIAKYGVKLGFMSFFVRAVVDSLKKYPRVNAYIEDNEIVYRHYYDISIAIGTDRG
LVVPVIRNCDQLSSGEIELQLADLASRAREGKLAIHELEGGGFTITNGGVYGSLLSTPII
NPPQVGILGMHKIEKRPVVREDAIVIADMMYVAMSYDHRIIDGKEAVGFLVNVKEQLEQP
ELLLKM
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagaggttcgtattcccaatatcgcagaatctattagtgaagtgacgatttct
gcacttttgattccatcaggagatttggtgcaggagaatcaagggattctggagatagag
agtgacaaggtgaatcagctcatttacgctccttgctcaggaaaggtagagtggagcgtt
tccgtaggagatacggtcgctgttggtagtgttgtagggattattagtgaagcggaaaag
agtcaagatactgcacctatccatgagcagatgccatttagtcttgtagagcaggaaagc
gatgcgcagattattgccttcccttcatcagtgagacaggatcctcctgcagaagggaaa
acttttgttccattaaaggagatccaaccagctgcttcttctgatcatagagaatctcga
gaatctatgagtgctattcggaagacgatttctcgtagattggtgcaatctctacatgat
tcagcaatgttaacgacatttaatgaaatccatatggggccgcttattgctctgcgtaag
gaaagacaagaagatttcattgcgaagtatggggtaaaacttgggttcatgtctttcttt
gttagagccgttgtagattctttgaaaaaatatccccgggtgaatgcttatattgaagat
aacgaaatcgtttacagacattactacgatatttccattgccatagggacagatcgtgga
ttagtagttcctgtaattcgtaattgtgatcagttatctagcggggagattgagttacag
cttgccgatttagcttctcgtgctcgggaaggcaaacttgctattcatgagttagaaggg
ggaggcttcactattaccaatggaggggtatatggttctcttctatccactcccattatc
aatcctccacaggtaggtattcttgggatgcataagatagagaaacgccctgtggttaga
gaagatgcaattgtgatagccgatatgatgtatgtagctatgagctatgatcatcggatt
atagacggaaaggaagccgtaggattccttgtgaatgttaaagagcaattagaacaaccc
gagcttttgctaaaaatgtag

DBGET integrated database retrieval system