KEGG   Chlamydia trachomatis B/Jali20/OT: JALI_0541Help
Entry
JALI_0541         CDS       T00960                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ctj  Chlamydia trachomatis B/Jali20/OT
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ctj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JALI_0541 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JALI_0541 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    JALI_0541 (sucB)
Enzymes [BR:ctj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     JALI_0541 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64275..65375
Genome map
AA seq 366 aa AA seqDB search
MSIEVRIPNIAESISEVTISALLIPSGDLVQENQGILEIESDKVNQLIYAPCSGKVEWSV
SVGDTVAVGSVVGIISEAEKSQDTAPIHEQMPFSLVEQESDAQIIAFPSSVRQDPPAEGK
TFVPLKEIQPAASSDHRESRESMSAIRKTISRRLVQSLHDSAMLTTFNEIHMGPLIALRK
ERQEDFIAKYGVKLGFMSFFVRAVVDSLKKYPRVNAYIEDNEIVYRHYYDISIAIGTDRG
LVVPVIRNCDQLSSGEIELQLADLASRAREGKLAIHELEGGGFTITNGGVYGSLLSTPII
NPPQVGILGMHKIEKRPVVREDAIVIADMMYVAMSYDHRIIDGKEAVGFLVNVKEQLEQP
ELLLKM
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagaggttcgtattcccaatatcgcagaatctattagtgaagtgacgatttct
gcacttttgattccatcaggagatttggtgcaggagaatcaagggattctggagatagag
agtgacaaggtgaatcagctcatttacgctccttgctcaggaaaggtagagtggagcgtt
tccgtaggagatacggtcgctgttggtagtgttgtagggattattagtgaagcggaaaag
agtcaagatactgcacctatccatgagcagatgccatttagtcttgtagagcaggaaagc
gatgcgcagattattgccttcccttcatcagtgagacaggatcctcctgcagaagggaaa
acttttgttccattaaaggagatccaaccagctgcttcttctgatcatagagaatctcga
gaatctatgagtgctattcggaagacgatttctcgtagattggtgcaatctctacatgat
tcagcaatgttaacgacatttaatgaaatccatatggggccgcttattgctctgcgtaag
gaaagacaagaagatttcattgcgaagtatggggtaaaacttgggttcatgtctttcttt
gttagagccgttgtagattctttgaaaaaatatccccgggtgaatgcttatattgaagat
aacgaaatcgtttacagacattactacgatatttccattgccatagggacagatcgtgga
ttagtagttcctgtaattcgtaattgtgatcagttatctagcggggagattgagttacag
cttgccgatttagcttctcgtgctcgggaaggcaaacttgctattcatgagttagaaggg
ggaggcttcactattaccaatggaggggtatatggttctcttctatccactcccattatc
aatcctccacaggtaggtattcttgggatgcataagatagagaaacgccctgtggttaga
gaagatgcaattgtgatagccgatatgatgtatgtagctatgagctatgatcatcggatt
atagacggaaaggaagccgtaggattccttgtgaatgttaaagagcaattagaacaaccc
gagcttttgctaaaaatgtag

DBGET integrated database retrieval system