KEGG   Chlamydia trachomatis B/Jali20/OT: JALI_0701Help
Entry
JALI_0701         CDS       T00960                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ctj  Chlamydia trachomatis B/Jali20/OT
Pathway
ctj00900  Terpenoid backbone biosynthesis
ctj01100  Metabolic pathways
ctj01110  Biosynthesis of secondary metabolites
ctj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ctj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JALI_0701 (dxr)
Enzymes [BR:ctj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     JALI_0701 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CAX10518
Position
84485..85624
Genome map
AA seq 379 aa AA seqDB search
MKHLALIGSTGSIGRQVLQVVRSIPDTFIIETLAAYGRNQEALISQIREFNPRVVAVREE
TTYKELRKLFPHIEILLGEEGLVSVATEPSVTMTIVASSGIDALPAVIAAIRQKKTIALA
NKESLVAAGELVTTLARENGVQILPIDSEHNALFQCLEGRDSSTIKKLLLTASGGPLRNK
SKEELQKVSLQEVLRHPVWNMGPKITVDSSTLVNKGLEIIEAFWLFGLEAVEIEAVIHPQ
SLVHGMVEFCDGTILSVMNPPSMLFPIQHVLTFPERSPAIGPGFDFLSNRTLEFFPIDED
RFPSVHLAKRVLLEKGSMGCFFNGANEALVHRFLAGEISWHQIVPKLQALVDQHRVQSCL
SLEEILSVDAEARARAQEC
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcatttagcactgatagggtcaacagggagtattggtagacaggttttacaagta
gttcgttctattcccgatacttttattatagaaactcttgctgcgtatggacggaatcaa
gaagcattgatttctcagattagagagtttaatcctcgcgtggtagccgttcgtgaagaa
acaacttacaaggagctccgtaagttattccctcatattgagattcttttaggagaagag
gggttagtttctgttgctacagaaccttctgtaacaatgaccattgtagcttcgtctggt
atagatgctttaccagcagtcattgcagctatccgacagaaaaagacaatagctttggct
aataaagagtcgttagtggcagctggagagttggttaccactttggctagagagaatggt
gtgcagattcttcccatcgatagtgaacataacgcacttttccagtgcttagaaggaaga
gactcttctaccattaaaaaattattgttaacagcttctggagggccgttaaggaataaa
tcaaaagaagaattacaaaaggtctctttacaagaggtcttgcgacaccctgtttggaat
atggggcccaaaattacagtagattcttctaccttagtaaataaaggcttagaaattata
gaagctttctggctatttgggctggaagctgtagagatagaggcggtgatccatcctcaa
agtcttgttcatggaatggtggagttttgtgatggaacgatcctttctgtgatgaatcct
cccagtatgctatttccaatacaacatgttttgactttcccagaacgtagccctgcaata
ggtccaggattcgattttctttcaaatcgcactctagagtttttcccgatagatgaagat
agattccctagtgttcatctagcaaagcgagtgcttcttgaaaaggggtctatggggtgt
tttttcaatggcgccaatgaggctttggttcatcgatttttagcaggcgagatttcttgg
catcaaatagttcctaaattacaagctcttgtggatcagcatcgcgtgcaatcctgttta
tccctggaagaaattctatcggtagatgctgaggccagagctcgtgctcaagagtgttaa

DBGET integrated database retrieval system