KEGG   Chlamydia trachomatis B/Jali20/OT: JALI_6371Help
Entry
JALI_6371         CDS       T00960                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ctj  Chlamydia trachomatis B/Jali20/OT
Pathway
ctj00860  Porphyrin and chlorophyll metabolism
ctj01100  Metabolic pathways
ctj01110  Biosynthesis of secondary metabolites
ctj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ctj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    JALI_6371 (hemB)
Enzymes [BR:ctj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     JALI_6371 (hemB)
Exosome [BR:ctj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JALI_6371 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: CAX11091
Position
722885..723901
Genome map
AA seq 338 aa AA seqDB search
MTRLPLLKRPRRNRKSAAVRSIIQETQLCSSDLIWPIFLKDGSGIREEIKSMPGVYRWSL
DMVSKELERLCTIGLKAVILFPVIDANKKEQFGSYASHPYNIVCKGIQAIKKSFPELCVI
SDIALDPFTTSGHDGIFHNNYVINDESVRVYGGIAVMHAEMGADIVAPSDMMDGRVKHIR
EQMDQMGFVNTGILSYSAKYASALYGPFRDALSSHLQSGDKRTYQMDPANVQEALLECQL
DEEEGADMVMIKPAGFYLDVIVKARENTHLPVVAYQVSGEFSMIMAACLHGWLNKESVIK
ESLLAIKRAGATAIISYATPWVLEWLAKDALPFERSVL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggcttccattactaaaacgacctcgcagaaaccgaaaaagtgcagccgttcga
tctataattcaagaaacccaactctgttctagtgacttgatctggcccatctttcttaaa
gatggctctggaattcgagaagaaataaagagtatgcctggagtatacagatggagttta
gacatggtctctaaagagttagagagactttgtacgataggattgaaagctgttatcctc
tttcctgtaattgatgctaataaaaaagaacaatttggatcctatgcgtcgcatccttac
aacattgtttgtaaagggattcaagcgataaaaaaatcttttccagaattatgtgtcatc
agtgacatagctttagatccttttacaaccagtggtcacgatgggatttttcataataac
tacgttatcaatgatgaaagtgtccgtgtatatgggggtatcgctgtcatgcatgcggaa
atgggagcagatattgttgctcctagcgatatgatggatgggagagtgaagcatattcga
gagcagatggatcagatggggtttgtcaacacgggtattctctcgtacagtgcaaaatat
gcatctgcattgtatggcccatttcgggatgctctttcttcacatcttcagtctggagat
aagcgtacatatcaaatggatcctgccaatgttcaagaagcgttgctagagtgtcagtta
gatgaagaagaaggcgctgatatggtgatgataaaacccgcaggtttttatctagatgta
atcgttaaagcgagagaaaacacccatcttccggtggtagcctatcaagtcagcggggaa
ttttctatgattatggctgcttgccttcatgggtggttaaacaaagaaagtgtaataaaa
gaatctttattagcgattaagagagctggtgcaacagctataattagttacgcaacacca
tgggttttagaatggctagctaaagatgctcttccctttgagagaagtgttctttga

DBGET integrated database retrieval system