KEGG   Chlamydia trachomatis B/Jali20/OT: JALI_6561Help
Entry
JALI_6561         CDS       T00960                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ctj  Chlamydia trachomatis B/Jali20/OT
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    JALI_6561 (recD)
Enzymes [BR:ctj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     JALI_6561 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
751128..752618
Genome map
AA seq 496 aa AA seqDB search
MNVNQHVQDIVQSLLAQHILLPFDIAFAQKHISQEEVSQEAEAFLATASALLRCGYPYFS
ICDKTIHPTLPGISSKQLFEWFQVLSSRIKEELFEVVNHKIYLRSLFLLREKVFHKLHRL
AGAVPRTPLIFEEIAQLSEEQNQVLKTVLNSCFSLVCGGPGTGKTFLAVQMIRLILAQIP
SAQIVVASPTGKASAHLHSVLTSQGIVGDSVEVVTIHKFLKDMRRGCSPVDLLLVDEGSM
VTINLLHGLIKTIRGEARGETIYADRMVIFGDANQLPPIGIGVGNPFHEVVSEFSKQACF
LSTSHRAKHKELQELASAVLRKELIPFQPLPSRQEAIRRLSFAFTQAAKEGVSLCALTPM
RQGLWGFLQLNRLLFNEMQEKHPQAPIPIIVTERYETWGLTNGDTGVLDPVTQQLRFTNG
EILHQADFPYYSYNYVMSVHKSQGSEYDRVIVILPKGSEVFDSAILYTAITRTKQHVEIW
ADREALEAIILKRGRY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtaaatcagcacgttcaagatattgtacaatctttgttagcacaacatattctt
ctcccttttgatatagcctttgctcaaaagcatatatcccaggaggaggttagtcaggaa
gcagaggctttcttagctacagcctctgcattattgcgttgtggatatccttatttttct
atctgtgataagacgattcatcccacgctcccagggatttcaagtaaacaactcttcgaa
tggttccaagtgttatcttctcgtataaaagaagaactgtttgaagtcgttaatcataaa
atctacctacgctcattatttcttttacgggagaaagtgtttcataagttgcataggttg
gcaggagctgtaccacgcacgcccttgatttttgaagagattgcacagctctcggaagag
cagaaccaggtacttaaaactgtattaaactcctgcttctctctcgtttgtggaggacca
ggaacaggaaaaacatttttagcagttcagatgattcggttgatacttgcgcaaattcct
tcagcgcagattgtagtagcttccccaacggggaaagcttccgctcatctgcatagcgta
ttaacatctcaggggatcgttggagattctgtagaagtcgttacgattcataaattttta
aaagatatgcgtagagggtgctcccctgtagatctactattggttgatgaaggatcgatg
gtgaccataaatctgttacatggactaatcaaaaccatacgaggagaagctcgaggggaa
acgatctatgcagatagaatggtgatttttggggatgcgaatcagcttcctccaataggt
attggagtgggaaatccttttcatgaagtagtgtctgagttttctaaacaggcatgcttt
ttatctaccagccaccgagctaaacataaggaattacaggaattagcgagcgctgttctg
cgcaaggagctgattccttttcaacctttgccttctcgacaagaagctattcggcgattg
tcttttgcttttacacaagcagcaaaagaaggggtgtcgttatgtgctttgactccgatg
cgccaaggactttgggggtttttgcagttgaatcggttgttgtttaatgagatgcaggag
aaacatccgcaggcgcctattcctatcatcgtgacagaaagatatgaaacgtggggatta
acgaatggggatacaggagttttagatcctgtaacgcaacaattgcgtttcacgaatggg
gagattctgcatcaagcagattttccctattattcttacaactatgtcatgtctgtgcac
aaaagtcagggtagtgaatatgatcgtgtgattgtcattcttcctaaaggcagtgaagtc
tttgattcggcaattctctatactgcaattacaagaaccaaacaacacgttgagatttgg
gctgatcgagaagctttagaggcgatcattttgaaaagagggcgttattaa

DBGET integrated database retrieval system