KEGG   Chlamydia trachomatis B/Jali20/OT: JALI_7881Help
Entry
JALI_7881         CDS       T00960                                 

Definition
hypothetical protein
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
ctj  Chlamydia trachomatis B/Jali20/OT
Brite
Enzymes [BR:ctj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     JALI_7881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
922169..923218
Genome map
AA seq 349 aa AA seqDB search
MSSLRIARSCSFKQKTLLAALVFFGLGASQVCATPSNSREIAWYVDYQEARDESREKDLP
MLLFFSGSDWNGSCMKIRDEVLSSSDFISAVADQFVCVVVDFPRHTELRDPLINEQNEDL
KNRLHVNTFPSLVLLSPEERAIYKIESFGNENGSNLGESLCRVIANDQELEQVFPFIPTL
SSVELRKYYQLAEELSRKDFMATALEQGVLCDDSFFLSEKFRQLVEAGRMDSEECRAVKN
RLLELDPENEQLTHFTVALIEFQELAKRSQGQSHVNVVEVIAPLAEYLTQFREQDKENQW
RLEMIISQYYLDAGLPNSALEHAKIAFESAPQDIQSSISRSLVHIEHQS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctttacggattgctagaagttgctctttcaagcagaaaactcttttggctgcc
ctagttttctttggactaggtgcgtctcaggtatgcgctactccttctaattccagagag
attgcttggtatgtagattatcaagaagctagggacgagagtagagagaaagatttgccc
atgttgttgtttttctctggctctgattggaatggtagttgtatgaaaatccgtgatgaa
gtgctaagctcgtcggatttcatctcagctgttgctgaccaatttgtgtgcgtagttgtc
gatttccctcgtcatacagagttgcgagatcctctcataaacgagcaaaatgaagattta
aagaatagactgcatgtcaataccttccctagtttggtattgttgtcccccgaagaacga
gcgatttataagatcgaaagttttggaaatgaaaatggatcgaatctaggagagagcttg
tgcagagtcattgctaatgaccaggaactagaacaagttttcccattcatccctacacta
tcttcggtagagttacgaaaatactatcagctcgctgaagagctatcgcgaaaagatttc
atggcaacagctcttgagcagggggtgttgtgcgatgatagctttttcctatccgagaag
tttcggcagctcgttgaagcgggtagaatggattcagaggagtgtcgtgctgtgaagaat
cggttgctagaattagatcctgagaatgagcagctcacgcatttcacagtggctttaatt
gaatttcaagagttagctaaacgttctcaagggcagtcgcacgtgaatgttgttgaagta
atcgcacctttagcagaatatcttacgcaatttagagaacaggataaagagaaccagtgg
agacttgagatgattatttctcaatattatctcgatgctgggctccctaatagtgcgcta
gagcacgcaaagatagcttttgaatcggctccgcaagatatccaatccagcatttcccgt
tcgttagtgcatatagaacaccaatcctaa

DBGET integrated database retrieval system