KEGG   Chlamydia trachomatis B/Jali20/OT: JALI_8101Help
Entry
JALI_8101         CDS       T00960                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ctj  Chlamydia trachomatis B/Jali20/OT
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ctj00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
942472..943338
Genome map
AA seq 288 aa AA seqDB search
MHFLSPAKLNLFLQILGRREDDFHEIVTRYQAIAFGDQLSLSISSRDSLQVINACHLETP
SNSIWKSVALFRRYTGITTPVSWRVVKQIPVGAGLAGGSSNAATALFALNQIFKTGLSDE
EMRSLAEQLGVDTPFFFSTGAALGVARGEKIIALEESVSDRYVLYFSSEGVLTSRAFAAV
QPSDCSSRKNLEYTQNDLEKPVFRLRLDLKEKKHWLESLWAELPVYIGLTGSGATLFVRY
PEILEKDLSYAAQIQRAVTLSGGLLTSPIRRDPTAWYSIYSESALAAT
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcactttctttctccagcaaagcttaatctctttttgcagatacttggcaggcgggaa
gatgattttcacgaaatagtcacacgctatcaagcgatagcctttggggatcaactctcc
ttatcaataagctctcgcgattctctccaagtaattaatgcttgtcatcttgaaacgcct
agtaattctatatggaaaagtgtggcgcttttccgtcggtacacaggcattacaacgcct
gttagttggcgtgtagtcaaacagatccctgttggagcaggtcttgcaggagggagtagt
aatgcagcaactgcattgtttgctttaaaccaaatcttcaaaacaggactatctgatgag
gaaatgcgttccttagccgaacagcttggcgtggatactccttttttcttttctacagga
gcagccttaggagtggcccgtggggagaaaataatagctctagaagagagtgtttcagat
agatatgttttgtatttttctagtgaaggagttctcactagtcgggcttttgccgccgta
caaccttcggactgttcctccagaaaaaatttagagtatacgcaaaatgacttagaaaag
cctgtttttcggttgcgcttagatttgaaagaaaagaaacattggctagaaagcctgtgg
gcggaacttcctgtgtatatagggctaacgggatcaggggcaaccttatttgtccgttac
ccagaaatcttagagaaagacctttcttatgcagctcagatacaaagagcagtaacgtta
agcggaggattattgacttctccgatacgaagagatcctacagcttggtatagcatctat
tctgaaagtgcacttgcagctacataa

DBGET integrated database retrieval system