KEGG   Chlamydia trachomatis RC-J(s)/122: CTRC122_00285Help
Entry
CTRC122_00285     CDS       T02770                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ctjs  Chlamydia trachomatis RC-J(s)/122
Pathway
ctjs00020  Citrate cycle (TCA cycle)
ctjs00310  Lysine degradation
ctjs01100  Metabolic pathways
ctjs01110  Biosynthesis of secondary metabolites
ctjs01120  Microbial metabolism in diverse environments
ctjs01130  Biosynthesis of antibiotics
ctjs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ctjs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTRC122_00285 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    CTRC122_00285 (sucA)
   00380 Tryptophan metabolism
    CTRC122_00285 (sucA)
Enzymes [BR:ctjs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CTRC122_00285 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C
Motif
Other DBs
NCBI-ProteinID: AGR99987
Position
60989..63700
Genome map
AA seq 903 aa AA seqDB search
MDSDFARHVHSSDIDWIESLFERFEKHEPMDSSWKYFFEGYQVGKTEGSPTESSHDQFFT
SLQEKKAHSLLMIYRYYGYLQGQVSPISSSEESSLVTEKVRNFDPQEEIPSLGLLPQSYV
RIADFIQVLKEKYCRSISVETLNCSPEIQEYVWKLMEGEKPSLTKEVLLARYRDVKRAVA
FEEFLQVKFTGKKRFSLEGGESLVPMLEHLIACGVKQGINRYVMGMPHRGRLNVLANIFG
KPYRQIFMEFEDAPQIRGLETVGDVKYHKGYVANRPEQNVMMALLPNPSHLESVDPVVEG
AVAAIQHQGEAGKEQACLAVLMHGDAALAGQGVVYETFQLSGIPGYSTEGTVHIVVNNQI
GFTAQPRESRSTPYCTDIAKMMGIPVFRVNGEDVLACLQVMEYAIHIRERFHCDVIIDLC
CYRKYGHNESDDPSVTAPFLYEEIKKKKQGSELFKEILLHHPEWNISSNELERIDTEIAH
VLNQEYASLKDPGVERLDECMHCTRMAAGELLVDNVDTSLDKEALFDLSAKLCDIPEHFS
PHAKIRSLLNKRMSMADGEIGYDWGMAEEVAFASLLQEGFSLRLSGQDSIRGTFSQRQLV
WTDVQTGDTFSPLYHLSPSQGSVELYNSPLSEYAVLGFEYGYAQQAEKTLVIWEAQFGDF
SNGAQIIFDQYISSGIQKWDLHSDVVVLLPHGYEGQGPEHSSARIERYLQLASDWNFQVV
LPSTPVQYFRILREHTKRDLSLPLIIFSPKMLLRHPQCVSSIAEFGMKGGFKPFLEDENP
NYHAKVLVLCSGKIYYDYRASLPKDLECRFACIRVESLYPLYLEDLLVLISKYTEVHHYV
WLQEEPQNMGAFSYFALATDEIFPSKLQCVCRPRSSSTATGSASLSQKELSMLMETLFSI
GRE
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggattcagactttgctaggcatgtgcattcatcagatattgactggatagaatctttg
ttcgagcgatttgagaagcatgagccgatggattcttcatggaaatatttctttgaaggt
tatcaagttgggaagacggaggggagcccaacagaatcttctcatgatcaattctttacg
tctttgcaagagaaaaaagcacacagtcttttgatgatataccgttattacggctattta
caggggcaagtgtctccaatatcctcatcagaagaatcttctctagttacagaaaaggtt
cgtaatttcgatcctcaagaagagattccttctttaggattattaccgcaatcttatgtt
cgtatagcagactttattcaggtattaaaagagaagtattgtcggagcatctctgttgag
acattgaattgctctcctgagatccaagaatatgtctggaaactcatggaaggagagaag
ccctctttaactaaagaagttcttctggcgcgatatcgagacgtaaaaagagcagtagct
tttgaagaatttttacaggttaaattcacaggaaaaaagcgcttttctctagaaggtgga
gagagcttggttcccatgttggagcatctcattgcttgtggggttaagcaaggcatcaat
cgttacgtgatgggaatgcctcatcgaggccgattaaacgttcttgctaacatttttgga
aagccttaccggcagattttcatggagtttgaagacgctccccaaataagagggctggaa
actgttggtgatgtaaagtaccacaagggatatgttgccaataggccggaacagaacgtt
atgatggctttattgccgaatccgagccatttagagtccgtggatcctgttgtggaaggt
gctgtagcagcgattcaacatcagggagaggctgggaaggagcaagcctgcttagctgtg
ttgatgcatggagatgcagccttggcgggtcagggcgttgtatatgaaactttccagttg
agtgggataccaggttattcaacagaaggaactgtgcatattgtagtgaataatcagata
ggtttcactgcgcagcctcgagagtctcgttctactccttattgtacagatatagctaaa
atgatggggatccctgtattccgagtgaatggagaggatgttttagcctgtctccaggtc
atggagtatgctatacatatccgtgagcgttttcattgtgatgtgattatcgacctctgt
tgttatcgaaaatacggtcacaatgaaagtgacgatccttctgttacagctccattttta
tacgaagagatcaaaaagaaaaaacaagggtcagaattattcaaagagatccttttacac
catcctgaatggaacatttcttccaacgagttggagagaatagacacagagatagcgcat
gttttaaaccaggagtacgcttctctgaaagatccaggtgtcgaacggctagatgaatgt
atgcattgcactcgtatggcagctggagagcttcttgtcgataatgtggatacatcgtta
gacaaagaagccttgtttgatctgagtgccaaactttgtgatattcctgagcatttttct
cctcatgcaaagattcgatctttattaaataagcgtatgagcatggctgatggagagatc
ggttatgattggggaatggctgaagaggtggcgttcgcttccttattacaagaaggtttt
tcattacgtttgtcaggacaagattctattcgtggaactttcagtcaacgacagttagtc
tggacggatgtccagacaggggatacattctctccattatatcacttgtctccgagtcaa
ggcagcgtggaattatacaattcccctctatctgaatacgctgttttaggctttgaatat
ggttatgcacaacaagcagaaaagactcttgttatttgggaagcgcagtttggagacttt
tccaatggagcccaaatcatttttgaccaatatatttcttccggaattcagaaatgggat
ttacattccgatgtagttgtactgcttcctcatggctatgaggggcaaggacctgagcat
tcctcggctcgtatagagcgttatttacagctcgcttccgattggaattttcaagttgtt
cttccttctactcccgtacagtattttcgtattctgcgggagcatacgaagagagacctc
tctcttcctcttatcattttttctcctaagatgttattgcggcatccgcagtgcgtgagt
tctatcgcagagtttggaatgaagggaggcttcaagcctttcttggaagacgagaatcct
aactatcatgcaaaagttcttgttctttgtagtggcaagatttattacgactatcgtgct
tctcttcctaaagatcttgaatgtcgttttgcttgtatacgagtagagagtttgtatcca
ttatacttagaagatctattggttctgataagcaaatatacggaagttcaccattatgta
tggttgcaagaagaacctcaaaatatgggcgcttttagttattttgcattagcaactgac
gagattttccctagcaaattgcagtgcgtttgccgtcctaggagtagttcaacggcaaca
ggatctgcgagtttaagtcaaaaagaattatcgatgttaatggaaaccctgttttctata
ggtagagagtag

DBGET integrated database retrieval system