KEGG   Chlamydia trachomatis J/6276tet1: CTJTET1_00290Help
Entry
CTJTET1_00290     CDS       T02762                                 

Gene name
sucA
Definition
2-oxoglutarate dehydrogenase E1 component (EC:1.2.4.2)
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ctjt  Chlamydia trachomatis J/6276tet1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ctjt01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ctjt00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ctjt00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
61027..63744
Genome map
AA seq 905 aa AA seqDB search
MDSDFARHVHSSDIDWIESLFERFEKHEPMDSSWKYFFEGYQVGKTEGSPTESSHDQVFT
SLQEKKAHSLLMIYRYYGYLQGQVSPISSSEESSLVTEKVRNFDPQEEIPSLGLLPQSYV
RIADFIQVLKEKYCRSIAVETLNCSPEIQEYIWKLMEGEKPSLTKEVLLARYRDVKRAVA
FEEFLQVKFTGQKRFSLEGGESLVPMLEHLIACGVKQGINRYVMGMPHRGRLNVLANIFG
KPYRQIFMEFEDAPQIRGLETVGDVKYHKGYVANRPEQNVMMALLPNPSHLESVDPVVEG
AVAAIQHQGEAGKEQACLAVLMHGDAALAGQGVVYETFQLSGIPGYSTEGTVHIVVNNQM
GFTAQPRESRSTPYCTDIAKMMGIPVFRVNGEDILACLQVMEYAIHIRERFHCDVIIDLC
CYRKYGHNEIDDPSVTAPFLYEEIKKKKQGSELFKEILLHHPEWNISSDELERIDTEIAH
VLNQEYASLKDPGVERLDKKECMHCTRMAAGELLVDNVDTSLDKEALFDLSAKLCDIPEH
FSPHAKIRSLLNKRMSMADGEIGYDWGMAEEVAFASLLQEGFSLRLSGQDSIRGTFSQRQ
LVWTDVQTGDTFSPLYHLSPSQGSVELYNSPLSEYAVLGFEYGYAQQAEKTLVIWEAQFG
DFSNGAQIIFDQYISSGIQKWDLHSDVVVLLPHGYEGQGPEHSSARIERYLQLASDWNFQ
VVLPSTPVQYFRILREHTKRDLSLPLIIFSPKMLLRHPQCVSSIAEFGMKGGFKPFLEDE
NPNYHAKVLVLCSGKIYYDYRASLPKDLEYRFACIRVESLYPLYLEDLLVLISKYTEVHH
YVWLQEEPQNMGAFSYFALATDEIFPSKLQCVCRPRSSSTATGSASLSQKELSTLMETLF
SIGRE
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atggattcagactttgctaggcatgtgcattcatcagatattgactggatagaatctttg
ttcgagcgatttgagaagcatgagccgatggattcttcatggaaatatttctttgaaggt
tatcaggttgggaagacggaggggagcccaacagaatcttctcatgatcaagtctttacg
tctttgcaagagaaaaaagcacacagtcttttgatgatataccgttattacggctattta
caggggcaagtgtctccaatatcctcatcagaagaatcttctctagttacagaaaaggtt
cgtaatttcgatcctcaagaagagattccttctttaggattattaccgcaatcttatgtt
cgtatagcagactttattcaggtattaaaagagaagtattgtcggagcatcgctgttgag
acattgaattgctctcctgagatccaagaatatatctggaaactcatggaaggagagaag
ccctctttaaccaaagaagttcttctggcgcgatatcgagacgtaaaaagagcagtagct
tttgaagaatttttacaggttaaattcacaggacaaaagcgcttttctctagaaggtgga
gagagcttggttcccatgttggagcatctcattgcttgtggggttaagcaaggcatcaat
cgttacgtgatgggaatgcctcatcgaggccgattaaacgttcttgctaacatttttgga
aagccttaccggcagattttcatggagtttgaagacgctccccaaataagagggctggaa
actgtcggtgatgtaaagtaccacaagggatatgttgccaataggccggaacagaacgtt
atgatggctttattgccgaatccgagccatttagagtccgtggatcctgttgtggaaggt
gctgtagcagcgattcaacatcagggagaggctgggaaggagcaagcctgcttagctgtg
ttgatgcatggagatgcagccttggcgggtcagggcgttgtatatgaaactttccagttg
agtgggataccaggttattcaacagaaggaactgtgcatattgtagtgaataatcagatg
ggtttcactgcgcagcctcgagagtctcgttctactccttattgtacagatatagctaaa
atgatggggatccctgtattccgagtgaatggagaggatattttagcctgtctccaggtc
atggagtatgctatacatatccgtgagcgttttcattgtgatgtgattatcgacctctgt
tgttatcgaaaatacggtcacaatgaaattgacgatccttctgttacagctccattttta
tacgaagagatcaaaaagaaaaaacaagggtcagaattattcaaagagatccttttacac
catcctgaatggaacatttcttccgacgagttggagagaatagacacagagatagcgcat
gttttaaaccaggagtacgcttctctgaaagatccaggtgtcgaacggctagataaaaaa
gaatgtatgcattgcactcgtatggcagctggagagcttcttgtcgataatgtggataca
tcgttagacaaagaagccttgtttgatctgagtgccaaactttgtgatattcctgagcat
ttttctcctcatgcaaagattcgatctttattaaataagcgtatgagcatggctgatgga
gagatcggttatgattggggaatggctgaagaggtggcgttcgcttctttattacaagaa
ggtttttcattacgtttgtcaggacaagattctattcgtggaactttcagtcaacgacag
ttagtctggacggatgtccagacaggggatacattctctccattatatcacttgtctccg
agtcaaggcagcgtggaattatacaattcccctctatctgaatacgccgttttaggcttt
gaatatggttatgcacaacaagcagaaaagactcttgttatttgggaagcgcagtttgga
gacttttccaatggagcccaaatcatttttgaccaatatatttcttccggaattcagaaa
tgggatttacattccgatgtagttgtactgcttcctcatggctatgaggggcaaggacct
gagcattcctcggctcgtatagagcgttatttacagctcgcttccgattggaattttcaa
gttgttcttccttctactcccgtacagtattttcgtattctgcgggagcatacgaagaga
gacctctctcttcctcttatcattttttctcctaagatgttattgcggcatccgcagtgc
gtgagttctatcgcagagtttggaatgaagggaggcttcaagcctttcttggaagacgag
aatcctaactatcatgcaaaagttcttgttctttgtagtggcaagatttattacgactat
cgtgcttctcttcctaaagatcttgaatatcgttttgcttgtatacgagtagagagtttg
tatccgttatacttagaagatctattggttctgataagcaaatatacggaagttcaccat
tatgtatggttgcaagaagaacctcaaaatatgggcgcttttagttattttgcattagca
actgacgagattttccctagcaaattgcagtgcgtttgccgtcctaggagtagttcaacg
gcaacaggatctgcgagtttaagtcaaaaagaattatcgacgttaatggaaaccttgttt
tctataggtagagagtag

DBGET integrated database retrieval system