KEGG   Chlamydia trachomatis J/6276tet1: CTJTET1_00290Help
Entry
CTJTET1_00290     CDS       T02762                                 

Gene name
sucA
Definition
2-oxoglutarate dehydrogenase E1 component (EC:1.2.4.2)
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ctjt  Chlamydia trachomatis J/6276tet1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ctjt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTJTET1_00290 (sucA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTJTET1_00290 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    CTJTET1_00290 (sucA)
   00380 Tryptophan metabolism
    CTJTET1_00290 (sucA)
Enzymes [BR:ctjt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CTJTET1_00290 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
61027..63744
Genome map
AA seq 905 aa AA seqDB search
MDSDFARHVHSSDIDWIESLFERFEKHEPMDSSWKYFFEGYQVGKTEGSPTESSHDQVFT
SLQEKKAHSLLMIYRYYGYLQGQVSPISSSEESSLVTEKVRNFDPQEEIPSLGLLPQSYV
RIADFIQVLKEKYCRSIAVETLNCSPEIQEYIWKLMEGEKPSLTKEVLLARYRDVKRAVA
FEEFLQVKFTGQKRFSLEGGESLVPMLEHLIACGVKQGINRYVMGMPHRGRLNVLANIFG
KPYRQIFMEFEDAPQIRGLETVGDVKYHKGYVANRPEQNVMMALLPNPSHLESVDPVVEG
AVAAIQHQGEAGKEQACLAVLMHGDAALAGQGVVYETFQLSGIPGYSTEGTVHIVVNNQM
GFTAQPRESRSTPYCTDIAKMMGIPVFRVNGEDILACLQVMEYAIHIRERFHCDVIIDLC
CYRKYGHNEIDDPSVTAPFLYEEIKKKKQGSELFKEILLHHPEWNISSDELERIDTEIAH
VLNQEYASLKDPGVERLDKKECMHCTRMAAGELLVDNVDTSLDKEALFDLSAKLCDIPEH
FSPHAKIRSLLNKRMSMADGEIGYDWGMAEEVAFASLLQEGFSLRLSGQDSIRGTFSQRQ
LVWTDVQTGDTFSPLYHLSPSQGSVELYNSPLSEYAVLGFEYGYAQQAEKTLVIWEAQFG
DFSNGAQIIFDQYISSGIQKWDLHSDVVVLLPHGYEGQGPEHSSARIERYLQLASDWNFQ
VVLPSTPVQYFRILREHTKRDLSLPLIIFSPKMLLRHPQCVSSIAEFGMKGGFKPFLEDE
NPNYHAKVLVLCSGKIYYDYRASLPKDLEYRFACIRVESLYPLYLEDLLVLISKYTEVHH
YVWLQEEPQNMGAFSYFALATDEIFPSKLQCVCRPRSSSTATGSASLSQKELSTLMETLF
SIGRE
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atggattcagactttgctaggcatgtgcattcatcagatattgactggatagaatctttg
ttcgagcgatttgagaagcatgagccgatggattcttcatggaaatatttctttgaaggt
tatcaggttgggaagacggaggggagcccaacagaatcttctcatgatcaagtctttacg
tctttgcaagagaaaaaagcacacagtcttttgatgatataccgttattacggctattta
caggggcaagtgtctccaatatcctcatcagaagaatcttctctagttacagaaaaggtt
cgtaatttcgatcctcaagaagagattccttctttaggattattaccgcaatcttatgtt
cgtatagcagactttattcaggtattaaaagagaagtattgtcggagcatcgctgttgag
acattgaattgctctcctgagatccaagaatatatctggaaactcatggaaggagagaag
ccctctttaaccaaagaagttcttctggcgcgatatcgagacgtaaaaagagcagtagct
tttgaagaatttttacaggttaaattcacaggacaaaagcgcttttctctagaaggtgga
gagagcttggttcccatgttggagcatctcattgcttgtggggttaagcaaggcatcaat
cgttacgtgatgggaatgcctcatcgaggccgattaaacgttcttgctaacatttttgga
aagccttaccggcagattttcatggagtttgaagacgctccccaaataagagggctggaa
actgtcggtgatgtaaagtaccacaagggatatgttgccaataggccggaacagaacgtt
atgatggctttattgccgaatccgagccatttagagtccgtggatcctgttgtggaaggt
gctgtagcagcgattcaacatcagggagaggctgggaaggagcaagcctgcttagctgtg
ttgatgcatggagatgcagccttggcgggtcagggcgttgtatatgaaactttccagttg
agtgggataccaggttattcaacagaaggaactgtgcatattgtagtgaataatcagatg
ggtttcactgcgcagcctcgagagtctcgttctactccttattgtacagatatagctaaa
atgatggggatccctgtattccgagtgaatggagaggatattttagcctgtctccaggtc
atggagtatgctatacatatccgtgagcgttttcattgtgatgtgattatcgacctctgt
tgttatcgaaaatacggtcacaatgaaattgacgatccttctgttacagctccattttta
tacgaagagatcaaaaagaaaaaacaagggtcagaattattcaaagagatccttttacac
catcctgaatggaacatttcttccgacgagttggagagaatagacacagagatagcgcat
gttttaaaccaggagtacgcttctctgaaagatccaggtgtcgaacggctagataaaaaa
gaatgtatgcattgcactcgtatggcagctggagagcttcttgtcgataatgtggataca
tcgttagacaaagaagccttgtttgatctgagtgccaaactttgtgatattcctgagcat
ttttctcctcatgcaaagattcgatctttattaaataagcgtatgagcatggctgatgga
gagatcggttatgattggggaatggctgaagaggtggcgttcgcttctttattacaagaa
ggtttttcattacgtttgtcaggacaagattctattcgtggaactttcagtcaacgacag
ttagtctggacggatgtccagacaggggatacattctctccattatatcacttgtctccg
agtcaaggcagcgtggaattatacaattcccctctatctgaatacgccgttttaggcttt
gaatatggttatgcacaacaagcagaaaagactcttgttatttgggaagcgcagtttgga
gacttttccaatggagcccaaatcatttttgaccaatatatttcttccggaattcagaaa
tgggatttacattccgatgtagttgtactgcttcctcatggctatgaggggcaaggacct
gagcattcctcggctcgtatagagcgttatttacagctcgcttccgattggaattttcaa
gttgttcttccttctactcccgtacagtattttcgtattctgcgggagcatacgaagaga
gacctctctcttcctcttatcattttttctcctaagatgttattgcggcatccgcagtgc
gtgagttctatcgcagagtttggaatgaagggaggcttcaagcctttcttggaagacgag
aatcctaactatcatgcaaaagttcttgttctttgtagtggcaagatttattacgactat
cgtgcttctcttcctaaagatcttgaatatcgttttgcttgtatacgagtagagagtttg
tatccgttatacttagaagatctattggttctgataagcaaatatacggaagttcaccat
tatgtatggttgcaagaagaacctcaaaatatgggcgcttttagttattttgcattagca
actgacgagattttccctagcaaattgcagtgcgtttgccgtcctaggagtagttcaacg
gcaacaggatctgcgagtttaagtcaaaaagaattatcgacgttaatggaaaccttgttt
tctataggtagagagtag

DBGET integrated database retrieval system