KEGG   Chlamydia trachomatis J/6276tet1: CTJTET1_04140Help
Entry
CTJTET1_04140     CDS       T02762                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ctjt  Chlamydia trachomatis J/6276tet1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ctjt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(904539..905813)
Genome map
AA seq 424 aa AA seqDB search
MKHALIVGSGIAGLSAAWWLHKRFPHIRLSILEKEARPGGLIITEKQKGFSFNMGPKGFA
LAHDGKHTLHLIQSLGLTGELVYNSPAAKHRFIHYNNKTRKLSPWTIFQQNLPLTLIKDL
FARPYKQDSSVEAFFKRHSSSKLRKNLLNPVSLAIRAGHSHILSAQMAYPELSLREAKTG
SLLRSYLKDFPRTNRKAPYLATLRTGMETLIQTLQEKLPATWHFSTPVTKIRQLANGKLS
LSCPSGEITGDLLVYAGSVQDLSSCLEEIPESKLLTQTTSSWDLSCTALGWHSSLLVPHG
YGMLFADTPPLLGIVFNTEIFPHSGQPNTVLSLLLEGRWHQEEAYAFSLAALAEHLQIYT
PPQAFSLFSPREGLPQHHVGFIRSRQIILSKLPKNIKIVGQNFAGPGLNRATASAYEAIA
SLRI
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatgcattgattgttgggtctggtattgcaggtctttctgcagcatggtggcta
cacaaacgctttccacatatacgcctgtccattttagaaaaggaagctcgccctggtggg
cttattatcaccgaaaaacaaaaaggtttttctttcaatatggggccaaaaggctttgcc
ttggcccatgatggaaaacataccctccacctcatccagtctttaggtttaacaggagag
ctagtatataactctcctgcagctaaacatcgatttattcactataataacaaaacgcga
aaactttctccctggaccatttttcaacaaaatctccctctcaccctgattaaggattta
tttgctcgcccttataaacaagatagttctgtagaagctttttttaaaaggcatagctcc
tccaaattaagaaaaaacctcttaaatccggtaagtcttgctattcgagcaggccacagt
catattctttcggcacaaatggcttacccagaattaagtctgcgagaagcaaaaacagga
tctttattgcggagttatctcaaagactttcctagaacaaatcgaaaagccccttattta
gctaccttacgcacaggaatggaaaccctaatccaaaccctgcaagaaaagcttccggct
acatggcacttttctacgcctgttaccaaaattcgtcagttagctaatggaaaactttct
ctctcgtgcccatctggagaaatcacgggagatctcctcgtctatgccggatccgttcaa
gatctctcttcttgtttagaagaaatcccagaatctaagctcctaacgcaaacaacttcc
tcttgggacctatcctgcacagcattagggtggcattcttcgcttctcgtcccccatggg
tatggtatgctttttgcagatacccctcccttattaggtattgtttttaacacagaaatc
tttcctcattctgggcaaccgaataccgtactctccctccttttagaggggaggtggcac
caagaagaagcttacgccttctctctagcggctcttgctgaacatttgcaaatttatacc
cctcctcaggctttctctctgttctctcctcgagaaggccttcctcaacatcatgtggga
tttattcgatcacgacaaattattttgtctaaacttcccaaaaacataaaaattgtgggg
caaaactttgcggggcctggtctaaaccgagcaacagcatctgcttacgaagcgattgct
tctttacgaatatga

DBGET integrated database retrieval system