KEGG   Chlamydia trachomatis E/150: E150_00175Help
Entry
E150_00175        CDS       T01903                                 

Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ctk  Chlamydia trachomatis E/150
Pathway
ctk03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    E150_00175
Enzymes [BR:ctk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     E150_00175
DNA repair and recombination proteins [BR:ctk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     E150_00175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 Helicase_RecD HHH_5 AAA_11 T2SSE PhoH UvrD-helicase AAA_12 HHH AAA_16 RsgA_GTPase AAA_22 DUF2075 AAA_29 ABC_tran AAA_28 Mg_chelatase Zeta_toxin HHH_2 Terminase_6
Motif
Other DBs
NCBI-ProteinID: ADH16796
Position
complement(36491..38731)
Genome map
AA seq 746 aa AA seqDB search
MGCEEKLSGILELILPEDPLSDQTGYAFLRVPYKNSLVTVCGHLPLSLFKIGSSVDLTGH
WSVDASGALVFRFTSAATYSPDSGIIAYLNAQIKGVGPKLAQKIVSTFGEDTLTVLDSCP
SKLVEVDGISPARCEDFSKQLQEQRDLRHALLFLQRHGIAIHYGLRLYKKYQNQTIEKVC
QDPFLLAKEMYGIGFKTADLIATCLGVPLNSPNRIVAGIQYSLDELQEEGHTCYPLNDFI
VLVEKLLNEEAPEEIIRKEEIRTQIHFLSRQKTVYVKELEQDTYIWSRQLFLAEQQIAID
IRRLLFSSKRIRSINTQEAILEVENLLDLKLEEKQKEALHASSSQKIHIISGGPGTGKST
ITRAILSIFEKISSPKKIILAAPTGKAAKRMTEITGKRTQTIHSLLQYDFKTLSFRKNHE
DPIDCDLVIVDESGMIDTILLQRFLAALPDHAILILIGDVHQLPSVGPGNVLKDLILSHH
IEVTYLTKIFRQLQNSNIITNAHKVNQGEFPVLNSSSGKKDFLFFQKEDPEEAIKHIIHL
VSDFVPKKFGIFTKDIQVLAPMRKGVLGILNLNRELKAALNPNKLFIQGKFHSFSTGDRV
MQTRNNYNKEVFNGDIGYVTSIDLSTKSLIVCVDGRYISYSQAELNDLIPAYATSIHKYQ
GSETSCIILPIHTSHYVMLYRNLLYTAITRGKKLVILVGTKKAVAIAVRNDKVQHRCTGL
QQAMHSLLNKPTPLFSPYTICRPSLG
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgggttgtgaagagaaactttccggtattttggagctgatcctgccagaagatcccctg
tccgatcaaacagggtacgccttcctacgagtcccttacaaaaattcactagtaactgtt
tgtggccatctcccgctctctttgttcaaaatcggctcctctgtagacttaacaggtcat
tggagtgtagatgctagcggagcattagtgtttcgctttacctccgctgcaacctatagt
cctgattccggaatcatagcttacctgaatgctcaaatcaaaggcgtaggccccaaactt
gctcaaaaaattgtctcaaccttcggggaagacacgttaacagtactcgattcctgtcct
tctaaattggtagaagtagatgggatttctcctgcccgctgcgaagatttttctaagcaa
ctccaagagcaaagagacctacgtcatgctttgttatttctacaacgacatggaatagcc
attcattatggtttacggctgtataaaaaataccaaaatcaaacgatcgagaaggtctgt
caagatccctttctgcttgcaaaggaaatgtacggtataggttttaaaaccgctgatctt
attgctacgtgcttaggagtccctctaaattcccctaatcgtatcgttgctggaattcaa
tactctctagatgaacttcaagaagaagggcatacctgctaccctcttaatgattttatt
gttctcgtagaaaaactgttgaatgaagaagctccagaggagatcatacggaaagaggaa
atccgtacccaaatccatttcttgtcacgccagaagacagtctatgtcaaggaactcgaa
caagatacctatatttggtcgcgccaactttttctagctgaacaacaaattgcgattgat
attcgaagactcttgttttcttctaaacgaatacgatctatcaatacccaggaagcgatt
ctggaggttgaaaatcttctggatttgaaattggaagaaaaacaaaaagaagctcttcat
gccagctcttcacaaaagattcatattatatctgggggaccaggaacaggaaaaagtaca
attacacgtgctatcctttctatctttgaaaagatctcctcccctaagaaaataatccta
gcagcacctacaggaaaagctgcgaaacgtatgacagaaatcacagggaaacgtactcaa
actatccactctcttctccagtatgatttcaaaaccttgtcatttcgaaagaatcacgaa
gatcctattgattgtgatcttgttattgtcgatgaatctggaatgatcgacaccattctc
ttacaacgctttctagctgcactgcctgatcatgctatcctaattctaattggagatgtg
caccagcttcccagcgtaggccctggtaatgtccttaaagatcttattctttcccatcac
atcgaggtaacctacctaacgaaaatcttccgtcagttgcaaaattcgaatatcattaca
aatgcccataaagtaaaccaaggagaattcccagttctcaacagctcttcagggaaaaaa
gactttttattttttcaaaaagaagaccctgaagaagcgattaaacacatcattcatctc
gtttcggattttgttcctaaaaaatttggtatctttaccaaagatattcaagtccttgct
cccatgagaaaaggggtattaggaatactcaatctaaatagagagttaaaagcagcactt
aatcctaataaactgtttatccaagggaaatttcactccttctctacgggagatcgcgtt
atgcaaacgcgtaataactataataaagaggtattcaacggagatatcggttatgtgacc
tctattgacctatctacaaagagtttgatcgtttgcgtggatggccgctatattagttat
tcgcaagcagaactcaatgacctgataccagcttatgctacttccatacacaaataccaa
ggaagtgagacctcctgtattattcttcctattcacacctctcattacgtgatgctgtat
agaaacttactctatacagcaattacacgagggaaaaaactagtcattttagtaggaaca
aagaaagcagttgctattgctgttcgtaatgacaaggttcaacaccgatgtaccgggctg
caacaagctatgcactcccttcttaacaaaccaactcctcttttctctccttacactatt
tgtagaccgtctctaggataa

DBGET integrated database retrieval system