KEGG   Chlamydia trachomatis E/150: E150_00295Help
Entry
E150_00295        CDS       T01903                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ctk  Chlamydia trachomatis E/150
Pathway
ctk00020  Citrate cycle (TCA cycle)
ctk00310  Lysine degradation
ctk01100  Metabolic pathways
ctk01110  Biosynthesis of secondary metabolites
ctk01120  Microbial metabolism in diverse environments
ctk01130  Biosynthesis of antibiotics
ctk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ctk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    E150_00295
  Amino acid metabolism
   00310 Lysine degradation
    E150_00295
Enzymes [BR:ctk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     E150_00295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: ADH16820
Position
63764..64861
Genome map
AA seq 365 aa AA seqDB search
MSIEVRIPNIAESISEVTISALLIPSGGLVQENQGILEIESDKVNQLIYAPCSGRVEWSV
SVGDTVAVGSVVGIISEAEKSQDTAPIHEQMPFSLVEQESDAQIIAFPSSVRQDPPAEGK
TFVPLKEIQPASSDHRESRESMSAIRKTISRRLVQSLHDSAMLTTFNEIHMGPLIALRKE
RQEDFVAKYGVKLGFMSFFVRAVVDSLKKYPRVNAYIEDNEIVYRHYYDISIAIGTDRGL
VVPVIRNCDQLSSGEIELQLADLASRAREGKLAIHELEGGGFTITNGGVYGSLLSTPIIN
PPQAGILGMHKIEKRPVVREDAIVIADMMYVAMSYDHRIIDGKEAVGFLVNVKEQLEQPE
LLLKM
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagaggttcgtattcccaatatcgcagaatccattagtgaagtgacgatttct
gcacttttgattccatcaggaggtttggtgcaggagaatcaagggattctggagatagag
agtgacaaggtgaatcagctcatttacgctccttgctcaggaagggtagagtggagcgtt
tccgtaggggatacggtcgctgttggtagtgttgtagggattattagtgaagcggaaaag
agtcaagatactgcacctatccatgagcagatgccatttagtcttgtagagcaggaaagc
gatgcgcagattattgccttcccttcatcagtgagacaggatcctcctgcagaagggaaa
acttttgttccattaaaggagatccaaccagcttcttctgatcatagagaatctcgagaa
tctatgagtgctattcggaagacgatttctcgtagattggtgcaatctctacatgattca
gcaatgttaacgacatttaatgaaatccatatggggccgcttattgctctgcgtaaggaa
agacaagaagatttcgttgcgaagtatggggtaaaactggggttcatgtctttctttgtt
agagccgttgtagattctttgaaaaaatatccccgggtgaatgcttatattgaagataac
gaaatcgtttacagacattactatgatatttccattgccatagggacagatcgtggatta
gtagttcctgtaattcgtaattgtgatcagttatctagcggggagattgagttacagctt
gccgatttagcttctcgtgctcgggaaggcaaacttgctattcatgagttagaaggggga
ggcttcactattaccaatggaggggtatacggttctcttctatccactcccattatcaat
cctccacaggcaggtattcttgggatgcacaagatagagaaacgccctgtggttagagaa
gatgcaattgtgatagccgatatgatgtatgtagctatgagctatgatcatcggattata
gacggaaaggaagccgtaggatttcttgtgaatgttaaagagcaattagaacaacccgag
cttttgctaaaaatgtag

DBGET integrated database retrieval system