KEGG   Chlamydia trachomatis E/150: E150_01065Help
Entry
E150_01065        CDS       T01903                                 

Definition
(GenBank) diphosphate--fructose-6-phosphate 1-phosphotransferase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ctk  Chlamydia trachomatis E/150
Pathway
ctk00010  Glycolysis / Gluconeogenesis
ctk00030  Pentose phosphate pathway
ctk00051  Fructose and mannose metabolism
ctk00680  Methane metabolism
ctk01100  Metabolic pathways
ctk01110  Biosynthesis of secondary metabolites
ctk01120  Microbial metabolism in diverse environments
ctk01130  Biosynthesis of antibiotics
ctk01200  Carbon metabolism
ctk01230  Biosynthesis of amino acids
ctk03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ctk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    E150_01065
   00030 Pentose phosphate pathway
    E150_01065
   00051 Fructose and mannose metabolism
    E150_01065
   00052 Galactose metabolism
    E150_01065
  Energy metabolism
   00680 Methane metabolism
    E150_01065
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    E150_01065
Enzymes [BR:ctk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     E150_01065
Protein phosphatases and associated proteins [BR:ctk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     E150_01065
Messenger RNA biogenesis [BR:ctk03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     E150_01065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADH16969
Position
230465..232126
Genome map
AA seq 553 aa AA seqDB search
MSSNKHASLCQKTPSLCRELQKAPALLLTEDIRFKALLNERIDSVAELFPCTYNSPYYKF
ISKSDLSAETSPLKVGVMLSGGPAPGGHNVILGLLHSIKKLHPNSQLLGFIRNGEGLLNN
NTVEITDEFIEEFRNSGGFNCIGTGRTNIITEENKARCLQTANELDLDGLVIIGGDGSNT
ATAILAEYFAKHQAKTVLVGVPKTIDGDLQHLFLDLTFGFDTATKFYSSIISNISRDALS
CKGHYHFIKLMGRSSSHITLECALQTHPNIALIGEEIAEKSISLETLIHDICETIADRAA
MGKYHGVILIPEGVIEFIPEIQSLVKEIESIPEQENLYQALSLSSQQLLCQFPEDICHQL
LYNRDAHGNVYVSKISVDKLLIHLVRQHLETHFRQVPFNAISHFLGYEGRSGTPTHFDNV
YSYNLGYGAGVLVFNRCNGYLSTIEGLTSPIEKWRLRALPIVRMLTTKQGKDSKHYPLIK
KRLVDIANPVFNKFSLYRKIWALEDSYRFVGPLQIHSPEDAHSDDFPPLILFLNHNEWQK
RCSICLEIPDQDY
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgaataaacatgcttctctttgtcaaaagacgccttctttgtgtcgggagctt
caaaaagctcctgctcttctattaacagaagacataaggtttaaagctcttcttaatgaa
cgcattgactctgttgcagaactatttccatgcacttataactctccctactacaaattt
atttcgaagtccgatctttccgctgagacctctccccttaaagtgggcgttatgctttct
ggaggcccagctcctggtgggcacaatgtcatcttaggattgctacacagtattaaaaag
ctccatccgaatagtcagcttttaggatttattcgcaatggagaaggacttctcaataat
aatactgtagaaatcacagatgaattcattgaagagtttcgtaactctggaggctttaat
tgcataggaacaggtcgcactaatatcataaccgaagaaaataaagcgcgctgtttacaa
acagcaaatgaactcgatttagatggattagtgattattggaggcgatggttcgaataca
gccacggcgattcttgctgaatattttgctaagcatcaagcaaaaacggtattagttggt
gttcctaaaactattgatggagatttgcagcacctatttttagacctcacatttgggttt
gatactgctactaaattttattcatccatcatcagcaacatttctagagacgcattatcg
tgtaaaggccactatcattttattaaactaatgggccggtcttcttctcatatcacgcta
gaatgcgcactacagactcacccaaatattgctcttataggcgaagagattgcagaaaaa
agcatctccttagaaacattaatccatgatatttgtgaaacaatagcagatcgagctgct
atggggaaataccatggcgttattctcatccctgaaggagtcattgagtttattcctgaa
atacagtctctggttaaagaaattgaatccattccagagcaggagaatctttaccaagct
ttatccttatcttctcagcaacttttatgccaatttccggaagatatttgccatcagctc
ttgtataatagagatgctcatggcaacgtctatgtatcaaaaattagtgttgataaactt
ctgattcatctagttcgtcaacatttagaaacacattttagacaagttcccttcaatgca
atctcccattttttaggttatgaagggcgttcaggaactcctacacattttgataatgtg
tatagctataacttaggatatggtgctggggttctcgtttttaaccgctgtaatgggtat
ttatccacgatcgaaggtctaactagccctattgaaaaatggcgattgcgcgctttaccc
attgttcgaatgttgacgaccaagcaggggaaagacagtaaacattatcctctgataaaa
aaaagattggtagatattgctaatcctgtttttaataagttctcactgtatcggaaaatc
tgggctttagaagactcctatcgctttgtagggccattacaaatacattctccggaggat
gctcattctgatgattttcctcctttaattttgtttttgaatcataatgaatggcaaaaa
cgctgttctatttgtttagaaatccccgatcaggattattaa

DBGET integrated database retrieval system