KEGG   Chlamydia trachomatis E/150: E150_01285Help
Entry
E150_01285        CDS       T01903                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ctk  Chlamydia trachomatis E/150
Pathway
ctk00010  Glycolysis / Gluconeogenesis
ctk00020  Citrate cycle (TCA cycle)
ctk00620  Pyruvate metabolism
ctk01100  Metabolic pathways
ctk01110  Biosynthesis of secondary metabolites
ctk01120  Microbial metabolism in diverse environments
ctk01130  Biosynthesis of antibiotics
ctk01200  Carbon metabolism
Module
ctk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ctk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    E150_01285
   00020 Citrate cycle (TCA cycle)
    E150_01285
   00620 Pyruvate metabolism
    E150_01285
Enzymes [BR:ctk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     E150_01285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 Transferase
Motif
Other DBs
NCBI-ProteinID: ADH17013
Position
275956..277245
Genome map
AA seq 429 aa AA seqDB search
MVSLLKMPKLSPTMEIGILVKWHKKAGDEIHFGDVLLEISTDKAVLEHTASEDGWLLEIL
VKEGTKTPIGTPIAVFSTEQNAQYDLKQLLPLEETVVTDAATEASPKDSAQTDSQYTSGP
SITMMGFRPEPPLATPLTIKHSNDPVLASPLAKKLAKEQNLDLSGVTGSGPGGRIVKKDL
EKAPPLRIAGFGYPEAPNVNPGSYIEEPLSPVREVISKRLQAAKTFIPHFYVRQRIYASP
LLALLKELQEQNIKLSINDCIVRACALALKEFPEINSGFNSVDNKIIRFSTIDISIAVAI
PDGVITPIVRCADRKNIGMISAEIKGLATKAKQQSLAEEEYKGGSFCVSNLGMTGISDFT
AILNPPQAAILAVGSVEEQPVVLNGELAVGSTCMLTLSVDHRVIDGYPAAMFMKRLQRLL
EAPSVLLLN
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggtttctttgttaaaaatgcctaagctctcccctacaatggaaatagggattcttgtt
aaatggcacaaaaaagctggggatgaaattcatttcggggatgtattactagaaatctct
actgataaagctgttttagaacatacagcttctgaagatggttggttattagaaattctt
gttaaagaaggaaccaaaactcctattggcactcctatcgctgtattttcaacagaacaa
aatgctcaatatgatttaaaacagctcctacctttggaagaaactgttgttacagatgca
gctacagaagcatcgccaaaagactctgctcaaacagattctcaatacacaagtggccct
tccataactatgatgggattccgtccggaaccacctttagctactcctctaactattaaa
cattccaacgatccagtattagcttctcctttagcaaaaaaattggccaaagagcaaaat
ctagacctctctggagtaactggtagtggacctggaggacggatcgtaaagaaagatttg
gaaaaagctcctcctttaagaattgctgggtttggttaccctgaagctccaaatgttaat
ccgggatcttatatagaagaacctctttcccctgttcgagaagtcatatctaaacgtctg
caagctgctaaaacctttattcctcacttttatgtaaggcagcgcatttacgcttccccc
cttcttgcattattaaaagaacttcaagaacaaaatattaagctctctatcaatgattgt
attgtacgagcctgtgctttagctctgaaagaattcccagaaattaattctggattcaat
agtgtcgacaataagattattcggttttctacgattgatatctctattgctgtagctatt
cctgatggagttatcactcctattgtccgctgtgctgatagaaaaaatattggtatgatc
tctgcagaaatcaaaggacttgcaactaaagccaaacagcagtctcttgcagaagaagaa
tacaaaggaggttctttctgtgtatctaatcttggtatgacagggatctctgatttcact
gctattttgaatcctccacaagctgctattctagctgtaggaagcgtagaggaacaacct
gtagtcttaaatggagagctagctgtaggctcgacctgtatgttgacattgtcggtagac
cacagagtgattgatggatatcctgcagccatgttcatgaaacgactgcagagactcctc
gaagctccttctgttttacttctcaattaa

DBGET integrated database retrieval system