KEGG   Chlamydia trachomatis E/150: E150_01715Help
Entry
E150_01715        CDS       T01903                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ctk  Chlamydia trachomatis E/150
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ctk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    E150_01715 (tpiA)
   01230 Biosynthesis of amino acids
    E150_01715 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    E150_01715 (tpiA)
   00051 Fructose and mannose metabolism
    E150_01715 (tpiA)
   00562 Inositol phosphate metabolism
    E150_01715 (tpiA)
Enzymes [BR:ctk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     E150_01715 (tpiA)
Exosome [BR:ctk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   E150_01715 (tpiA)
  Exosomal proteins of bladder cancer cells
   E150_01715 (tpiA)
  Exosomal proteins of melanoma cells
   E150_01715 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
369838..370662
Genome map
AA seq 274 aa AA seqDB search
MFTDKETHRKPFPTWAHLLHSEPSKQFVFGNWKMNKTLTEAQTFLKSFISSDILSNPQII
TGIIPPFTLLSACQQAVSDSPIFLGAQTTHEADSGAFTGEISAPMLKDIGVDFVLIGHSE
RRHIFHEQNPVLAEKAAAAIHSGMIPVLCIGETLEEQESGATQDILLNQLTIGLSKLPEQ
ASFILAYEPVWAIGTGKVAHPDLVQETHAFCRKTIASLFSKDIAERTPILYGGSVKADNA
RSLALCPDVNGLLVGGASLSSENFLSIIQQIDIP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtttacagacaaagaaactcacagaaaaccatttccaacttgggcccaccttctccac
tctgagccatcaaagcaatttgttttcggtaattggaaaatgaacaagacgcttaccgaa
gctcagacctttttaaaaagtttcatctctagtgacattctgtctaatccccaaatcatt
acaggaatcattcctcctttcacactgctgtcagcttgtcaacaagctgtaagcgattcc
cccatctttcttggagcccaaaccactcatgaagctgactcaggagcttttactggtgag
atttcagccccaatgctcaaagatatcggagtcgattttgttctcatcggacattccgaa
agacgtcatatctttcatgaacaaaatcctgtacttgctgaaaaagctgctgcagctatc
catagtggaatgattccagttctgtgtattggagaaactttagaagaacaagaatctgga
gcaactcaagatattcttttaaatcaactgactataggattatctaaactccctgagcaa
gcctctttcattctagcttatgaaccagtctgggctataggcaccggaaaagtagctcat
cctgatctagttcaggaaacccatgctttctgtagaaaaacgattgcttctctcttttcc
aaagatattgcggaacgcacccccattctttacggaggatctgtgaaagccgataatgct
cgctcacttgccctctgccctgatgttaatggtcttttagttggaggagcctctttatct
tcagagaatttcttatccattatacaacaaatcgatatcccataa

DBGET integrated database retrieval system