KEGG   Chlamydia trachomatis E/150: E150_03240Help
Entry
E150_03240        CDS       T01903                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ctk  Chlamydia trachomatis E/150
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ctk00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(692718..694070)
Genome map
AA seq 450 aa AA seqDB search
MTSWNFVCLSLGSNLGNRHEHIRRAYASLKKAGIRNLKSSVILETKALLLEGAPKEWDLP
YFNSVVIGETQLSPDELIEEIKMIESCFGQDASLKWGPRPIDIDVLFYGDEAFSYHSDKC
TIPHPKVLERPFLLSMMASLCPYRRFRLEGSSCNGKTFAELAAIYPLTEEDALGSFGSAT
QIMGIVNITDNSISDTGLFLEARRAAAHAERLFAEGASIIDLGAQATNPRVKDLGSVEQE
WERLEPVLRLLAERWGAAQQCPDVSIDTFRPEIIRRAVEVFPIRWINDVSGGSLEMAHLA
KEFGLRLLINHSCSLPPRPDCVLSYEESPIEQMLRWGESQLEQFAQVGLDTSWQVVFDPG
IGFGKTPVQSMLLMDGVKQFKRVLECPVLIGHSRKSCLSMLGRFNSNDRDWETIGCSVSL
HDRGVDYLRVHQVEGNRRALAAAAWAGMFV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgactagttggaattttgtttgtttaagtttgggttccaatttaggtaaccggcatgag
catataagacgcgcttatgcaagtttaaagaaggctgggatccgaaatttaaaaagttct
gtaattttagagacgaaggctttgttgttagaaggggctccgaaagaatgggatcttcct
tattttaactctgtggttattggggaaacgcagctatctccagacgagttgattgaagaa
atcaagatgatagaaagttgttttggacaagatgcttctttgaaatgggggcctcgaccg
attgatattgatgtgcttttctatggagacgaagctttttcttatcatagtgacaaatgt
acaatcccacatcctaaggtattagaaagaccttttcttctttctatgatggcttcttta
tgtccgtatcgtcgtttccgtttggaaggatcttcttgtaatgggaaaacgtttgcagag
cttgctgctatttatccattgacggaggaggatgcgttaggcagtttcggttctgctacc
caaattatgggtattgttaatattacggataactcgatctccgatacaggattgtttctg
gaggcgagaagagccgcagcccatgctgagagactctttgcagaaggagcttctattatt
gatttaggggcgcaagcaaccaatcctcgtgtaaaagatttaggaagcgtagaacaagag
tgggagcgtctagaacctgttttgcgtttattagcggagcggtggggggctgctcaacaa
tgccctgatgtatctatcgatacatttcgtccagagattattcgacgagctgttgaagta
tttccgattcgttggatcaatgatgtttctggaggctctttggaaatggctcatttggcg
aaggagtttgggctacggctattaataaatcattcgtgttcgctgcctccaagaccagat
tgtgtactttcttatgaagaatctcctattgagcaaatgttgcgttggggagagtcccag
ttagaacaatttgctcaagtaggtttagatacaagttggcaagttgttttcgatccagga
ataggatttgggaagactcccgttcagtcgatgttattgatggatggagtaaagcagttt
aaacgtgttttagagtgtcctgtattaataggccattctagaaaatcgtgtttgagtatg
ttgggccgatttaatagtaacgatcgtgattgggaaacgatcggctgttctgtatctctt
catgatcgaggagttgattatctacgcgtgcatcaggttgaaggtaacagacgtgcctta
gccgctgctgcttgggctggtatgtttgtatga

DBGET integrated database retrieval system