KEGG   Chlamydia trachomatis E/150: E150_03360Help
Entry
E150_03360        CDS       T01903                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ctk  Chlamydia trachomatis E/150
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    E150_03360
Enzymes [BR:ctk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     E150_03360
Exosome [BR:ctk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   E150_03360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
720700..721716
Genome map
AA seq 338 aa AA seqDB search
MTRLPLLKRPRRNRKSAAVRSIIQETQLCSSDLIWPIFLKDGSGIREEIESMPGVYRWSL
DMVSKELERLCTIGLKAVILFPVIDANKKEQFGSYASHPYNIVCKGIQAIKKSFPELCVI
SDIALDPFTTSGHDGIFHNNYVINDESVRVYGGIAVMHAEMGADIVAPSDMMDGRVKHIR
EQMDQMGFVNTGILSYSAKYASALYGPFRDALSSHLQSGDKRTYQMDPANVQEALLECQL
DEEEGADMVMIKPAGFYLDVIVKARENTHLPVVAYQVSGEFSMIMAACLHGWLNKESVIK
ESLLAIKRAGATAIISYATPWVLEWLAKDALPFERSVL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggcttccattactaaaacgacctcgcagaaaccgaaaaagtgcagccgttcga
tctataattcaagaaacccaactctgttctagtgacttgatctggcccatctttcttaaa
gatggctctggaattcgagaagaaatagagagtatgcctggagtatacagatggagttta
gacatggtctctaaagagttagagagactttgtacgataggattgaaagcagttatcctc
tttcctgtaattgatgctaataaaaaagaacaatttggatcctatgcgtcccatccttac
aacattgtttgtaaagggattcaagcgataaaaaaatcttttccagaattatgtgtcatc
agtgacatagctttagatccttttacaaccagtggtcacgatgggatttttcataataac
tacgttatcaatgatgaaagtgtccgtgtatatgggggtatcgctgtcatgcatgcggaa
atgggagcagatattgttgctcctagcgatatgatggatgggagagtgaagcatattcga
gagcagatggatcagatggggtttgtcaacacgggtattctctcgtacagtgcaaaatat
gcatctgcattgtatggcccatttcgggatgctctttcttcacatcttcagtctggagat
aagcgtacatatcaaatggatcctgccaatgttcaagaagcgttgctagagtgtcagtta
gatgaagaagaaggcgctgatatggtgatgataaaacccgcaggtttttatctagatgta
atcgttaaagcgagagaaaacacccatcttccggtggtagcctatcaagtcagcggggaa
ttttctatgattatggctgcttgccttcatgggtggttaaacaaagaaagtgtaataaaa
gaatctttattagcgattaagagagctggtgcaacagctataattagttacgcaacacca
tgggttttagaatggctagctaaagatgctcttccctttgagagaagtgttctttga

DBGET integrated database retrieval system