KEGG   Chlamydia trachomatis E/150: E150_03845Help
Entry
E150_03845        CDS       T01903                                 

Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ctk  Chlamydia trachomatis E/150
Pathway
ctk00010  Glycolysis / Gluconeogenesis
ctk00260  Glycine, serine and threonine metabolism
ctk00680  Methane metabolism
ctk01100  Metabolic pathways
ctk01110  Biosynthesis of secondary metabolites
ctk01120  Microbial metabolism in diverse environments
ctk01130  Biosynthesis of antibiotics
ctk01200  Carbon metabolism
ctk01230  Biosynthesis of amino acids
Module
ctk_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ctk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    E150_03845
  Energy metabolism
   00680 Methane metabolism
    E150_03845
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    E150_03845
Enzymes [BR:ctk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     E150_03845
Membrane trafficking [BR:ctk04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    E150_03845
Exosome [BR:ctk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   E150_03845
  Exosomal proteins of melanoma cells
   E150_03845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADH17518
Position
complement(834356..835036)
Genome map
AA seq 226 aa AA seqDB search
MTLLILLRHGQSAWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPIDCIFTSTLVRSL
MTALLAMTNHSSQKVPYIVHEERPDMSRIHSQKEMEQMIPLFQSSALNERMYGELQGKNK
QEVAAQFGEEQVKLWRRSYRIAPPQGESLFDTGQRTLPYFQERIFPLLQQGKNIFISAHG
NSLRSLIMDLEKLSEEQVLSLELPTGQPIVYEWTGQKFTKHAPSLG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttcttatcttgctacgccatggccaatccgcatggaatcaaaaaaatctgttt
acaggctgggtagacatccctcttagccaacaaggaattcaagaggctattgccgctgga
gaatctattaaacatcttcctattgattgcatcttcacttccaccttggttagaagtttg
atgacagccctgttagcaatgactaaccacagctctcaaaaagttccttatatcgttcat
gaagagcgccccgacatgagccggattcatagtcaaaaagaaatggagcagatgatccct
ctttttcaatctagcgctctcaatgaacgcatgtacggagaacttcaaggaaaaaataaa
caagaagtcgctgctcaattcggagaagaacaggtaaaactgtggcgccgaagctaccgc
attgcccctcctcagggcgaaagtcttttcgatacagggcaacgaaccctcccctatttt
caagagagaattttccctctccttcagcaagggaaaaatatttttatctctgctcacggg
aattctttgcgctccttaattatggacctagaaaaattatctgaagaacaagtactctct
ttggagttgccaacaggacagcctattgtatacgaatggacgggacaaaaattcacgaaa
cacgctccttctcttggttaa

DBGET integrated database retrieval system