KEGG   Chlamydia trachomatis E/150: E150_03970Help
Entry
E150_03970        CDS       T01903                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ctk  Chlamydia trachomatis E/150
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ctk00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(866614..867888)
Genome map
AA seq 424 aa AA seqDB search
MKHALIVGSGIAGLSAAWWLHKRFPHVQLSILEKESRSGGLIVTEKQQGFSLNMGPKGFV
LAHDGQHTLHLIQSLGLADELLYSSPEAKNRFIHYNNKTRKVSPWTIFKQNLPLSFAKDF
FARPYKQDSSVEAFFKRHSSSKLRRNLLNPISIAIRAGHSHILSAQMAYPELTRREAQTG
SLLRSYLKDFPKEKHTGPYLATLRSGMGMLTQTLHDKLPATWYFSAPVSKIRQLANGKIS
LSSPQGEITGDMLIYAGSVHDLPSCLEEIPETKLIKQTTSSWDLSCVSLGWHASLPIPHG
YGMLFADTPPLLGIVFNTEVFPQPERPNTIVSLLLEGRWHQEEAYAFSLAAISEYLQIYT
PPQAFSLFSPREGLPQHHVGFIQSRQRLLSKLPHNIKIIGQNFAGPGLNRATASAYKAIA
SLLP
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatgctctcattgttggctcaggtattgccggcctttctgccgcgtggtggcta
cacaaacgattccctcatgtgcagctgtctattctagaaaaagagtctcgatctggaggg
ctaattgtcacagagaaacaacaagggttttccctcaatatgggccctaaaggttttgtt
ttagctcatgatgggcaacacacccttcacctcattcagtctttaggcctagcagacgag
ctattatatagctctccagaggctaaaaaccgctttatccactataataataaaacccga
aaagtctcgccttggactattttcaaacaaaatctccctctctcctttgctaaggatttc
tttgcgcgtccttacaaacaagacagctccgtggaagccttctttaaaagacacagttct
tccaagcttagaagaaatcttttaaatcccattagcattgctattcgtgcaggacatagt
catatattgtctgcacagatggcttacccagaattaacacgaagagaagctcaaacagga
tcgttgttacgtagttatctcaaagattttcctaaagagaaacacacaggcccttattta
gctaccttgcggtctgggatgggaatgctaacccagactttgcatgataaattgcctgct
acctggtatttttctgcacccgtcagcaaaatccgtcagttggcgaacgggaaaatttct
ctttcatctcctcaaggagaaataacgggagatatgctcatttatgctgggtccgtgcac
gatctcccttcctgtctagaagagatccctgaaaccaagcttatcaagcaaacgacttca
tcttgggatctctcttgtgtatctttaggatggcatgcatccctccctatccctcatgga
tatggcatgcttttcgctgatacgcctcccttattagggatcgtgtttaatacggaagtg
ttccctcaacccgagcggcctaatacaatagtctctcttcttttagaaggtcgatggcac
caagaagaagcgtatgctttctcactagcagctatttctgagtacctgcaaatttacact
cctccccaagctttctcactattctctcctcgagagggacttccccaacaccatgttgga
tttatccaatcccgccaacgccttctatctaaacttcctcacaatataaaaattataggg
cagaattttgcaggtccaggtctcaaccgcgctacagcgtctgcttataaagctatagct
tctttactaccatga

DBGET integrated database retrieval system