KEGG   Chlamydia trachomatis E/150: E150_04130Help
Entry
E150_04130        CDS       T01903                                 

Definition
(GenBank) 3'(2'),5'-bisphosphate nucleotidase
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ctk  Chlamydia trachomatis E/150
Pathway
ctk00920  Sulfur metabolism
ctk01100  Metabolic pathways
ctk01120  Microbial metabolism in diverse environments
ctk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ctk00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    E150_04130
Enzymes [BR:ctk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     E150_04130
Transfer RNA biogenesis [BR:ctk03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    E150_04130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P zf-BED
Motif
Other DBs
NCBI-ProteinID: ADH17575
Position
complement(908118..909146)
Genome map
AA seq 342 aa AA seqDB search
MFSLLNDCQKAAETVVMQAMLSLMRYRKAHKFIPFWKKPDQTYVTPADYAIQYYFYQKLT
SLFPHIPLVGEETLNPATDHPRIPQILQFAQQLDPKVSCQDLYQALSPESSHSSLFWLTD
PIDGTSGFIKQRCFAIALSLFYEHTPVLSVIACPSSKNNSFKIYSAAKGEGLTICNPTHS
FPFSLHEDFQPTCKFCEASLSARNHQHLATHILSKHLPWNPQPIRADSQCKYAWVADNTV
DFFIRIPYSPPRAHYRDHAPGVFLIEEAGGLVTDISGNPLPFSNPNLYLDRHPLILASAN
EQMHSTILETLYKLRHQATQNMLPLAAHVSATKHKQLSALQL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgttctccctcctcaatgactgccaaaaagctgcggaaacagttgtcatgcaggctatg
ctgtcactgatgcgctatcgaaaagctcataaatttattcccttttggaaaaagcctgac
cagacatacgttactcccgctgattacgctatccaatattatttttaccaaaaactgaca
tctttatttccgcatatcccgctggtcggagaagaaactctcaatcctgccacggatcac
cctaggatccctcaaatcctacaatttgcgcagcagctcgatcccaaagtctcctgtcaa
gatttgtatcaggccctctctccggaaagctcccactcttcactattttggttaacggac
cctatcgacggtacttcgggattcatcaaacaacgttgtttcgccatcgctctttctcta
ttttacgaacatacccctgttctctccgttatcgcttgcccttcttccaaaaataactct
ttcaaaatctattcggcagccaaaggcgaaggacttacgatttgtaatcctacccattcc
ttccccttctccctgcacgaagatttccagcctacctgtaaattctgtgaagcctcctta
tcagctagaaaccatcaacatttagctacacatattctcagtaaacatctcccttggaat
cctcagcctatccgagcagatagtcaatgcaaatacgcttgggttgcagataatacggta
gacttcttcattcgcatcccgtattcccctccacgagcccactacagagaccatgctcct
ggtgtgtttcttatagaagaagctggaggcctcgttacagatatatcggggaatcctctc
cctttttctaatccaaatttatatctagatagacatcctttgattcttgcttctgctaac
gagcaaatgcatagcacgattttagagactctatacaaactacgtcaccaagctactcaa
aacatgctcccccttgccgctcatgtctctgctactaagcataaacagctaagcgctctt
caactatag

DBGET integrated database retrieval system