KEGG   Chlamydia trachomatis L2b/UCH-1/proctitis: CTLon_0091Help
Entry
CTLon_0091        CDS       T00646                                 

Gene name
pgmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ctl  Chlamydia trachomatis L2b/UCH-1/proctitis
Pathway
ctl00010  Glycolysis / Gluconeogenesis
ctl00260  Glycine, serine and threonine metabolism
ctl00680  Methane metabolism
ctl01100  Metabolic pathways
ctl01110  Biosynthesis of secondary metabolites
ctl01120  Microbial metabolism in diverse environments
ctl01130  Biosynthesis of antibiotics
ctl01200  Carbon metabolism
ctl01230  Biosynthesis of amino acids
Module
ctl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ctl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTLon_0091 (pgmA)
  Energy metabolism
   00680 Methane metabolism
    CTLon_0091 (pgmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTLon_0091 (pgmA)
Enzymes [BR:ctl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CTLon_0091 (pgmA)
Membrane trafficking [BR:ctl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CTLon_0091 (pgmA)
Exosome [BR:ctl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CTLon_0091 (pgmA)
  Exosomal proteins of melanoma cells
   CTLon_0091 (pgmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAP06489
UniProt: B0BAH7
Position
complement(113666..114346)
Genome map
AA seq 226 aa AA seqDB search
MTLLILLRHGQSVWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPIDCIFTSTLVRSL
MTALLAMTNHSSQKVPYIVHEERPDMSRIHSQKEMEQMIPLFQSSALNERMYGELQGKNK
QEVAAQFGEEQVKLWRRSYRIAPPQGESLFDTGQRTLPYFQERIFPLLQQGKNIFISAHG
NSLRSLIMDLEKLSEEQVLSLELPTGQPIVYEWTGQKFTKHAPSLG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttcttatcttgctacgccatggccaatccgtatggaatcaaaaaaatctgttt
acaggctgggtagacatccctcttagccaacaaggaattcaagaggctattgccgctgga
gaatctattaaacatcttcctattgattgcatcttcacttccaccttggttagaagtttg
atgacagccctgttagcaatgactaaccacagctctcaaaaagttccttatatcgttcat
gaagagcgccccgacatgagccggattcatagtcaaaaagaaatggagcagatgatccct
ctttttcaatctagcgctctcaatgaacgcatgtacggagaactccaaggaaaaaataaa
caagaagtcgctgctcaattcggagaagaacaggtaaaactgtggcgccgaagctaccgc
attgcccctcctcagggcgaaagtcttttcgatacagggcaacgaaccctcccctatttt
caagagagaattttccctctccttcagcaagggaaaaatatttttatctctgctcacggg
aattctttgcgctccttaattatggacctagaaaaattatctgaagaacaagtactctct
ttggagttgccaacaggacagcctattgtatacgaatggacgggacaaaaattcacgaaa
cacgctccttctcttggttaa

DBGET integrated database retrieval system