KEGG   Chlamydia trachomatis L2b/UCH-1/proctitis: CTLon_0091Help
Entry
CTLon_0091        CDS       T00646                                 

Gene name
pgmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ctl  Chlamydia trachomatis L2b/UCH-1/proctitis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ctl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTLon_0091 (pgmA)
   01230 Biosynthesis of amino acids
    CTLon_0091 (pgmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTLon_0091 (pgmA)
  Energy metabolism
   00680 Methane metabolism
    CTLon_0091 (pgmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTLon_0091 (pgmA)
Enzymes [BR:ctl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CTLon_0091 (pgmA)
Exosome [BR:ctl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CTLon_0091 (pgmA)
  Exosomal proteins of melanoma cells
   CTLon_0091 (pgmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(113666..114346)
Genome map
AA seq 226 aa AA seqDB search
MTLLILLRHGQSVWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPIDCIFTSTLVRSL
MTALLAMTNHSSQKVPYIVHEERPDMSRIHSQKEMEQMIPLFQSSALNERMYGELQGKNK
QEVAAQFGEEQVKLWRRSYRIAPPQGESLFDTGQRTLPYFQERIFPLLQQGKNIFISAHG
NSLRSLIMDLEKLSEEQVLSLELPTGQPIVYEWTGQKFTKHAPSLG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttcttatcttgctacgccatggccaatccgtatggaatcaaaaaaatctgttt
acaggctgggtagacatccctcttagccaacaaggaattcaagaggctattgccgctgga
gaatctattaaacatcttcctattgattgcatcttcacttccaccttggttagaagtttg
atgacagccctgttagcaatgactaaccacagctctcaaaaagttccttatatcgttcat
gaagagcgccccgacatgagccggattcatagtcaaaaagaaatggagcagatgatccct
ctttttcaatctagcgctctcaatgaacgcatgtacggagaactccaaggaaaaaataaa
caagaagtcgctgctcaattcggagaagaacaggtaaaactgtggcgccgaagctaccgc
attgcccctcctcagggcgaaagtcttttcgatacagggcaacgaaccctcccctatttt
caagagagaattttccctctccttcagcaagggaaaaatatttttatctctgctcacggg
aattctttgcgctccttaattatggacctagaaaaattatctgaagaacaagtactctct
ttggagttgccaacaggacagcctattgtatacgaatggacgggacaaaaattcacgaaa
cacgctccttctcttggttaa

DBGET integrated database retrieval system