KEGG   Chlamydia trachomatis L2b/UCH-1/proctitis: CTLon_0149Help
Entry
CTLon_0149        CDS       T00646                                 

Definition
protein disulfide isomerase
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
ctl  Chlamydia trachomatis L2b/UCH-1/proctitis
Brite
Enzymes [BR:ctl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CTLon_0149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
195327..195821
Genome map
AA seq 164 aa AA seqDB search
MRNWLLGSLLIACMAVTAPCFAAKRRAAGSQKINRVAETGIHWMSYQDALNKAKQEGKHV
AVFFTGSDWCIWCMRMQDQILQTAAFSEFAKQYLCMVEIDFPHNKEQTAEQKEQNRHLKS
LYSVDGFPTLVFLDSEGKEVAKMGFEPGGGEAYVYRLKQALHIS
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagaaactggttattagggagcttgctcatcgcatgtatggcggtcacagctccttgt
tttgctgcaaaacgtcgtgctgcgggttcgcagaagatcaatagggttgcagagaccgga
attcactggatgtcttatcaagatgctttgaataaggcaaaacaggaaggaaagcatgta
gccgtatttttcacaggatccgattggtgtatttggtgtatgagaatgcaggatcagatt
ttacaaacagctgcattttccgagtttgctaaacaatatttgtgtatggtggagatagat
ttccctcacaacaaagaacaaactgcagaacaaaaagagcagaatcgtcatttgaaaagt
ttatattctgtagacggattccctaccctagttttcctcgattccgaaggtaaagaagtc
gcaaaaatgggatttgagcctggaggcggagaggcatatgtttatagattaaagcaagca
ttacatatctcctga

DBGET integrated database retrieval system