KEGG   Chlamydia trachomatis L2b/UCH-1/proctitis: CTLon_0578Help
Entry
CTLon_0578        CDS       T00646                                 

Gene name
tpiS
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ctl  Chlamydia trachomatis L2b/UCH-1/proctitis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ctl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTLon_0578 (tpiS)
   01230 Biosynthesis of amino acids
    CTLon_0578 (tpiS)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTLon_0578 (tpiS)
   00051 Fructose and mannose metabolism
    CTLon_0578 (tpiS)
   00562 Inositol phosphate metabolism
    CTLon_0578 (tpiS)
Enzymes [BR:ctl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CTLon_0578 (tpiS)
Exosome [BR:ctl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CTLon_0578 (tpiS)
  Exosomal proteins of bladder cancer cells
   CTLon_0578 (tpiS)
  Exosomal proteins of melanoma cells
   CTLon_0578 (tpiS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
687940..688764
Genome map
AA seq 274 aa AA seqDB search
MFTDKETHRKPFPTWAHLLHSEPSKQFVFGNWKMNKTLTEAQTFLKSFLSSDILSNPQII
TGIIPPFTLLSACQQAVSDSPIFLGAQTTHEADSGAFTGEISAPMLKDIGVDFVLIGHSE
RRHIFHEQNPVLAEKAAAAIHSGMIPVLCIGETLEEQESGATQDILLNQLTIGLSKLPEQ
ASFILAYEPVWAIGTGKVAHPDLVQETHAFCRKTIASLFSKDIAERTPILYGGSVKADNA
RSLSLCPDVNGLLVGGASLSSENFLSIIQQIDIP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtttacagacaaagaaactcacagaaaaccatttccaacttgggcccaccttctccac
tctgagccatcaaagcaatttgttttcggtaattggaaaatgaacaaaacgcttaccgaa
gctcagacctttttaaaaagtttcctctctagtgacattctgtctaatccccaaatcatt
acaggaatcattcctcctttcacactgctgtcagcttgtcaacaagctgtaagcgattcc
cccatctttcttggagcccaaaccactcatgaagctgactcaggagcttttactggtgag
atttcagccccaatgctcaaagatatcggagtcgattttgttctcatcggacattccgaa
agacgtcatatctttcatgaacaaaatcctgtacttgctgaaaaagctgctgcagctatc
catagtggaatgattccagttctgtgtattggagaaactctagaagaacaagaatctgga
gcaactcaagatattcttttaaatcaactgactataggattatctaaactccctgagcaa
gcctctttcattctagcttatgaaccagtctgggctataggcaccggaaaagtagctcat
cctgatctagttcaggaaacccatgctttctgtagaaaaacgattgcttctctcttttcc
aaagatattgcggaacgcacccccattctttacggaggatctgtgaaagccgataatgct
cgctcactttccctctgccctgatgtgaatggtcttttagttggaggagcctctttatct
tcagagaatttcttatccattatacaacaaatcgatatcccataa

DBGET integrated database retrieval system