KEGG   Chlamydia trachomatis L2b/UCH-1/proctitis: CTLon_0711Help
Entry
CTLon_0711        CDS       T00646                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ctl  Chlamydia trachomatis L2b/UCH-1/proctitis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ctl00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ctl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(847983..849317)
Genome map
AA seq 444 aa AA seqDB search
MPGIKVFGETVLRGSVRVSGAKNATTKLLVASLLSDQRTILKNVPNIEDVRQTVDLCRVL
GAIVEWDQQAQVIEIHTPRILLSKVPPQFSCVNRIPILLLGALLRRCPYGIFVPILGGDA
IGPRTLHFHLEGLKKLGAEIVISDEGYWASAPNGLVGAHITLPYPSVGATENLILASVGA
QGRTIIKNAALEVEIIDLIVFLQKAGVEITTDNDKTIEIFGCQDFYSVEHFIIPDKIEAA
SFGMAAVVSQGRIFVEQARHEHMIPFLKVLRSIGGGFSVHENGIEFFYDKPLKGGVLLET
DVHPGFITDWQQPFAVLLSQSEGCSVIHETVHENRLGYLKGLVKMGAHCDLFHECLSAKS
CRYSTGNHPHSAVIHGPTPLQATDLVIPDLRAGFAYVMAALIAEGGASWIENTEMLDRGY
TDWRGKLERLGAKVLARDAVSVYV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtatcaaggtttttggagaaacggtcttaagaggatctgtgcgcgtgtcagga
gctaaaaatgctacaactaaattacttgtagcctccttactttcggatcagcgaacgatt
ttaaagaacgtccctaatattgaagatgttcggcaaacggtagatctttgtcgggtttta
ggggcgattgtagagtgggatcagcaagcgcaagtgattgaaattcacactccgcgcatt
ttattgtccaaggttcctccgcaattttcttgtgttaatcggattcctattttgctgtta
ggagcgttgttacgtcgttgtccttatgggatttttgttcctattttgggaggggatgct
ataggacctcgtacgctacatttccatttagaaggattgaagaagcttggagcagagata
gtaattagtgatgaaggctattgggcttcagctccaaatggtcttgttggagcacacatc
acgttaccctacccttctgtgggagccacagaaaacctcatccttgcttctgtaggggct
caaggacgaacgattattaagaatgctgctcttgaagtggaaatcattgatttgattgtc
tttttacagaaagcaggcgtggagattacaacagataatgataagaccatcgaaattttt
ggatgtcaggatttctattctgttgagcacttcattattccagataaaatcgaggctgct
tctttcggtatggctgcggtagtttctcagggaaggatcttcgtagaacaagcgcgccat
gagcatatgatcccttttttaaaggtattaagatcgataggagggggattctctgtacat
gagaatgggatcgaatttttctacgataagcctttgaaagggggtgttcttctagaaacg
gatgtgcatccagggtttattacagattggcaacaaccttttgccgtattgctctctcag
tcagaaggttgttcggtgatccatgagacagtgcatgagaatcgtcttgggtatttgaaa
ggtttggtaaaaatgggagcgcattgtgatttatttcacgagtgtttgagtgctaagtcg
tgtcgctattctacagggaatcatcctcatagcgcagtcattcatggtccgactcctttg
caggcaacagacttagtgattcctgatttgcgcgcaggatttgcttatgtcatggccgca
ctcattgcagaaggcggagcctcatggattgagaataccgagatgctggatcgagggtac
actgattggcgagggaaattagaaagattaggagctaaggttttagcgcgagacgcagta
tctgtgtatgtttaa

DBGET integrated database retrieval system