KEGG   Chlamydia trachomatis L1/440/LN: L1440_00455Help
Entry
L1440_00455       CDS       T02571                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ctll  Chlamydia trachomatis L1/440/LN
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ctll00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
499715..500386
Genome map
AA seq 223 aa AA seqDB search
MPLYLGLNPSSAKQYSAVFQPIIRIVPFSKHVPQIRHARKFLVSASHILLTSPSSTACFF
SSIRKRIPLSLFRNKSFVTIGEASSSRVKAFLPKANIVQSAFPQAEAFLPILSTLPSSSS
LLYPHSVLARPILRSLLQTLPFSSFSYPHYTVKPITLSVSTFLPHKTIILTSPSIVRAYA
QLFPCLPDKEHWCLGEISAAEFKQIFHTPPSKILFSTKEPTGC
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgtacttaggcctcaatccatcctctgctaaacaatattctgctgtttttcag
cctattattcgcatagtccctttttcaaaacacgttcctcaaatacgacatgctaggaag
ttccttgtatcagcttcccatattttgttaacaagcccctcttctaccgcttgttttttt
tcttccattaggaaaagaatccctttatccctgttcaggaataaatccttcgttaccata
ggagaagcctcttcttctcgtgtaaaggcctttctccccaaagctaatattgtgcaaagc
gcattccctcaagcagaagcatttcttcccatcctatcgactcttccttccagctcctcc
ctactctatcctcactctgtactcgctcgtcccattctccgctctcttctacaaacactc
cctttctcctccttttcctatcctcattatacagttaaacccattacactttccgtaagt
acctttcttccccataaaactattattctcactagcccttctatcgttcgtgcctatgca
caactatttccctgcctccctgataaagaacactggtgtctaggagagattagtgcagca
gaattcaaacagatatttcacactcctccttccaaaattcttttttcaactaaagaaccg
acaggatgttga

DBGET integrated database retrieval system