KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A0009Help
Entry
Cabther_A0009     CDS       T01629                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cabther_A0009
Enzymes [BR:ctm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cabther_A0009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(9211..9834)
Genome map
AA seq 207 aa AA seqDB search
MPKHDEQTKPESNEGMELLTAARALQRMLEALRLTADRDTHLERTAENVAEFWAEFFAPF
IADQPPPVVSTFPAAELSGQFIAVGGMSFHSMCAHHLTPFFGAAYVAYVPAALAMGIGAP
AKLLEHAARRPQLQERLAMDVATAIERVCHPQGVAVCLIARQMCMEMRGVRADGSVESTV
LRGCFQEAPWREQFFNYLSRQATSRGG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagcacgacgagcaaaccaagccagagagcaatgaggggatggaactgctgacg
gcagcgcgcgccctgcaacgcatgctggaggcgctgcggctgaccgcagaccgtgatact
catctggagcgcacggcggaaaacgttgcggagttctgggcggagttttttgcacccttc
attgcagaccagccaccgccggtggtttcaacctttccggccgcagagctgtccggtcag
ttcattgccgttggcgggatgtcgttccattcgatgtgcgcccaccatctgacgccgttt
ttcggcgcagcttacgtggcttacgtccccgccgcgctggcgatgggcattggcgcgccg
gccaaactgcttgagcacgcggcacgccggccgcagcttcaggaacgcctggccatggat
gtcgctactgctatcgagcgggtgtgtcatccccaaggcgtggccgtctgcctgattgcg
cgtcagatgtgcatggaaatgcgcggcgttcgcgcggacgggtctgtggaaagcaccgtc
ctgcggggatgctttcaggaagccccgtggcgcgagcagtttttcaactatctttcccgc
caggcaaccagccggggcgggtga

DBGET integrated database retrieval system