KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A0324Help
Entry
Cabther_A0324     CDS       T01629                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Cabther_A0324
Enzymes [BR:ctm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Cabther_A0324
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Cabther_A0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:390579..391442
Genome map
AA seq 287 aa AA seqDB search
MPELPEVEGVARELQQRLQQRRVIGVRIYRPRLVAPQSVATVVAGMQGAVFTEVGRRGKH
LLLHLDNAHTLLVHLRMAGRFLYLAPDAPLPKFTHAVFDLDNDRRLVFQDQRHFAIMRLA
PTAALFQLEELRHLAPEPLGPDFTLDYLQRTLAGTRRPIKEVLLDQTRVAGLGNIYAAEV
LFAVGLHPLTPANLVSKSKVKDLWKTIRVLLEAAIEAGTTLDVNPENITGQYFGAAFAEA
LLVYDREGEPCIRCETPIARIRQGQRSTYFCPRCQRPRAGMGRQTAK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgccggagcttcctgaagtcgaaggcgtcgcgcgtgagttgcagcagcgccttcaacag
cggcgggtcattggcgtccgcatttaccgtccgcgcctcgttgcgccacagtctgtcgcc
acggtcgtcgcagggatgcagggggccgtgtttaccgaagtcgggcggcgcggcaagcac
ctgctgctacacctggacaatgcccataccctgctcgttcacctgcggatggccggccgg
tttctgtatctggcacctgacgccccactgccaaagttcacccacgccgtctttgacctc
gacaacgaccgtcgcctggtgtttcaggaccagcggcacttcgccatcatgcggctggca
cccacggccgcattgttccagcttgaggaactgcgccatctcgcgcccgaaccgctgggg
ccggatttcaccctggactacctgcagcgcacgctggccggcacgcggcgtcccatcaag
gaagtcctgctcgaccagacgcgcgtagccgggttgggaaatatctacgcagcggaagtc
ctctttgccgtcggtctccatcccctcaccccggccaatctggtatccaaatccaaggtc
aaagacctgtggaagaccatccgcgtcctgctggaggccgccatcgaagccggcacgacc
cttgacgtgaacccggaaaacatcaccgggcagtattttggcgcggcttttgccgaggct
ttgctcgtgtatgaccgggaaggcgaaccctgcatccgctgtgaaactcccattgcccgg
attcgccaggggcaacgctcgacctacttctgccccaggtgtcagcgcccacgtgccgga
atgggacgacaaactgcaaaatga

DBGET integrated database retrieval system