KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A0328Help
Entry
Cabther_A0328     CDS       T01629                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cabther_A0328
Enzymes [BR:ctm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Cabther_A0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:395231..396142
Genome map
AA seq 303 aa AA seqDB search
MTSPDTATGLAVVARQPYTWQLRRGGLTLGATTRLMGIINVTPDSFSDGGRYTTVEAALA
QAQRLVAEGADILDIGGESTRPGAQTVDEAEEMARVIPVIEAVAQAVDVPLSIDTYKASV
AEAALAAGAVIVNDISGFRFDDRMPEVIARHGAGVVVMHSRGTPGALHGLPPVADILADV
TAGFEHSLEVARTAGIGLDSIVFDPGLGFGKTLEDNLLLLGTLPRLAALGRPLLVGPSRK
SFIGRVTGKADPSDRLLGTAASVALAIAGGAHIVRVHDVAAMRECAALVDAVRNTVFPNS
EPV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacatctcctgatacggcaactggtctggcggtcgtggcgcggcagccttacacttgg
cagcttcgccggggcggcctgacgctgggtgccacaacccgcctgatgggcatcatcaac
gtcacgccggattcgttttccgacggtggacgctacaccacggtcgaagctgccctggcc
caggcgcaacggcttgtcgccgaaggggctgacatccttgacatcggcggggaatccacc
cgccccggcgcgcaaacggtggacgaggctgaggaaatggcgcgggtcattcccgtgatc
gaggctgtggcccaggctgtggacgtgccgctttcaatcgacacctacaaggcttccgtt
gccgaagccgcgctggcggccggcgccgtgattgtcaacgacatttcgggctttcgtttc
gatgaccgcatgccagaagtcattgcgcggcacggcgctggcgtcgtggtgatgcacagt
cgcggcacgcccggcgctctgcacggtttgcctccggtggcggacattctggcggatgtc
acggctggctttgagcacagcctggaggttgcccgcacagccggcatcgggttggacagc
atcgtgttcgaccccggactgggttttggcaagaccctcgaagacaacctgttgctgctt
ggtacgctaccgcgtctggcggcgctggggcggccgctgctcgtcgggccttcacgcaag
tccttcatcggcagggtgacaggcaaagctgacccctccgaccggcttctgggaactgcc
gccagtgtggctttggcgattgccggtggcgcgcatatcgtccgcgtccacgacgtagcc
gccatgcgcgaatgtgcggcgctggtggatgccgtccgcaacactgtttttccaaacagc
gaaccggtgtga

DBGET integrated database retrieval system