KEGG   Chloracidobacterium thermophilum: Cabther_A0470Help
Entry
Cabther_A0470     CDS       T01629                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cabther_A0470
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cabther_A0470
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cabther_A0470
Enzymes [BR:ctm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cabther_A0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:545955..547334
Genome map
AA seq 459 aa AA seqDB search
MSSEGFPRATAYLQCIETTCRATYDASERIYTCEQCGGLLDVQYEWQRARLFDVLETFDA
RRASFHPHDTSGVWRFRELLPFVTSPAQIVTLGEGNTPVWDAPRSAGYAGLKRLAVKHQG
LNPTGSFKDNGMTTGMAQARRLGARAVACASTGNTSASLAAYAARAGVHGIVFIPGGRIA
YGKLAQSLDYGAVTLQIEGNFDDAMRLVRELARTTPLYLLNSVNPFRLEGQKTIAFELLQ
QRRWRVPDWVVVPGGNLGNVSALGKGFKELHNLGLIARLPRLAVVQAEGAAPLAQWYAAG
QTGNLAPVARPKTLATAIQIGNPVSWLKAVRALEWTNGVCAVVSEQEIADAKAMLGRDGI
GCEPASAATVAGLRRLVSERVVDPDADVVAILTGNALKDPDFTVQYHTGQLYTDAERETH
LTHAEGKLVPTFANTPRQVPADATVLRQVILDLLETPPA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtgaaggcttcccacgcgccacagcctatcttcagtgcatcgagacaacctgc
cgggccacctacgacgccagcgagcgaatctacacctgcgagcagtgcggtggtttgctc
gatgtgcagtacgaatggcaacgcgcccggttgttcgatgtactggagaccttcgatgcc
cggcgtgcgtcttttcatccacacgacaccagcggcgtctggcgttttcgtgaactgctg
ccctttgtgacttcgccggcgcagatcgtcactctgggcgaaggcaacaccccagtgtgg
gatgcgccacgcagcgccggctatgccggtctcaaacggctggcggtgaagcaccagggt
ctcaatccgaccggttccttcaaggacaacggcatgacgaccggcatggcgcaggcccgc
cggctgggcgcgcgggccgtggcctgtgccagtaccggcaacacttcggcttcgctggcc
gcctatgctgcgcgcgccggtgttcacggaattgtcttcatccccggcgggcgcattgcc
tacggtaaactggcgcaaagtctcgattacggtgcggtgacgctccagattgaaggcaac
ttcgacgatgccatgcggctggttcgggaactggcccgtaccacgccgctgtatctgctc
aactcggtcaatccattccggcttgaagggcaaaagaccattgccttcgagctgttgcag
cagcgccggtggcgcgtacccgactgggttgtggtgcccggcggcaatctcggcaatgtc
tcggcgctgggcaagggcttcaaagaactgcataacttggggctgatcgcacggcttccc
cggttggccgtcgttcaggcggaaggggcagcgccgctggcgcagtggtacgcagccggc
cagaccggcaatcttgcgcctgtggcgcggcccaagaccctggccacggcgattcagatt
ggtaatcccgtgtcgtggctgaaagccgttcgcgccctggagtggacaaacggtgtgtgt
gccgtggtttccgaacaggaaattgccgacgccaaagctatgctggggcgcgacggcatc
ggctgtgaaccggccagcgccgccaccgtggctggactccggcgactggtcagcgaaagg
gttgttgacccggatgccgacgtggtggcgattctgaccggcaacgccctcaaggacccg
gacttcacggtgcagtaccacaccgggcagctctacaccgacgccgaacgtgaaacgcac
cttacccacgccgaagggaagcttgtcccgacctttgccaacacgccacggcaggttccg
gcggatgccaccgttctgcggcaggtcatcctcgaccttctggaaacaccgccggcctga

DBGET integrated database retrieval system