KEGG   Candidatus Chloracidobacterium thermophilum B: Cabther_A0573Help
Entry
Cabther_A0573     CDS       T01629                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ctm  Candidatus Chloracidobacterium thermophilum B
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Cabther_A0573
Enzymes [BR:ctm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Cabther_A0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:675807..676445
Genome map
AA seq 212 aa AA seqDB search
MLVVVSSPSGGGKSTLLSRLLKSVDNLYYSVSYTTRPPRPGERHGEHYYFVSPDDFERMR
EHGEFLESALVHGHFYGTHRKFVETRLEQGHDLILDIDVQGAESVANIMPEATRIFIMPP
SYEVLRQRLCARGSDHPQTIARRLRNATQEVRRFREFHYVIVNDDLERALHSLICIITAE
RERWRLSEKWLEAIVDTFDAESLPLEGETPKL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgctggtggtggtttcctcgccgtcagggggagggaaatccacgctcctgagtcgtctg
ctgaagtcagtggacaatctctactattcggtttcctacaccacacgcccgccacgtccc
ggcgaacggcacggcgagcactactactttgtctcgccggacgacttcgagcgcatgcgc
gagcacggggagttcctggaatcagcgctggtgcacggtcacttttacggtacgcaccgg
aagttcgtcgaaacgcgcctggaacagggccacgatctcattctcgacattgatgtgcag
ggcgcggaaagcgtggccaacatcatgccggaagcgacccggattttcatcatgccaccc
agttatgaggtgctgcgccagcggctctgcgcccgtgggagtgaccacccacagacgatt
gcccggcggctgcgcaatgccacgcaggaagtacggcgttttcgggagtttcactatgtt
atcgtcaatgatgacctggaacgcgcgctccactcgctcatctgcatcattacggcggag
cgtgagcgctggcgcctgtcagaaaaatggctcgaagccattgtggacacgtttgatgct
gaatctttgccactggaaggagagacacccaagttatga

DBGET integrated database retrieval system